KEGG   Thermoanaerobacter italicus: Thit_0362Help
Entry
Thit_0362         CDS       T01178                                 

Definition
(GenBank) uroporphyrin-III C-methyltransferase
  KO
K13542  uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
tit  Thermoanaerobacter italicus
Pathway
tit00860  Porphyrin and chlorophyll metabolism
tit01100  Metabolic pathways
tit01110  Biosynthesis of secondary metabolites
tit01120  Microbial metabolism in diverse environments
Module
tit_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:tit00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Thit_0362
Enzymes [BR:tit01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     Thit_0362
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Thit_0362
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 TP_methylase
Motif
Other DBs
NCBI-ProteinID: ADD01677
JGI: Thit_0362
UniProt: D3T6R4
Position
405682..407175
Genome map
AA seq 497 aa AA seqDB search
MSGIVYLIGAGPGDIGLLTLRAVELIKNADVLVYDRLINEDILKMAKKDAELIDVGKFPD
NHKVPQSKINEIIAKKALSGKKVARIKGGDPFVFGRGGEEAEYLSQKRIPYEVVPGITSA
VAVLSYAGIPVTHRDLSSSFHVITGHEREGKDKNLDWEVISKLEGTLVFLMGIKNIEKIV
QKLLNYGKDPHTPAAVVMEGTTPEQKVVTGKLIDIPSLVRKEGIKNPGVFAVGDVVALRD
RLKWYENKKLFGKRILLTRTYEQSQQMKKILSEEGADVVVCPTIKITPFLDNIVKFLEEI
HKFDYAVFTSVNGVWSFIEASREKRFDLRNLSIKVVAIGSKTAEALENIFIYPDIIPEEY
TSYSLANALKKHVEGKNIALLTSQIGGDILLESLGNYANVQKIVAYKNEPNYEIKGNLIS
ELRKGVDIAVFTSSSTFNYMHQLIRDEINLLKNSKIAAIGPVTKKAIEDKGFNVDIMPSE
YTTEKLIEEILKNHQSL
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgtcagggattgtatatttgatcggagcaggacctggagatattgggcttttaacattg
agagcagtcgaactaataaaaaatgcagatgtgctggtgtatgataggctcattaatgaa
gatattttaaaaatggcaaaaaaggatgcagagcttattgatgttggaaagtttccggat
aatcacaaagtacctcaaagtaaaataaacgaaataattgcgaaaaaggccctttctggc
aagaaagtagcgagaattaaaggaggagacccatttgtattcggaagaggtggcgaagag
gctgaatacctttcacaaaaaagaataccttatgaggtagtgccaggcataacatctgca
gtggctgtcctatcctatgcaggaattcctgtaactcatagagatttaagctcttcattt
catgtaataacgggtcatgaacgggaaggaaaagataaaaacctcgattgggaggtcata
tcaaaactcgaggggacacttgtatttctcatggggataaaaaatatagaaaaaattgtg
caaaaacttctcaattacggcaaagatcctcatacaccagcagcagtagtaatggagggc
actactccagagcaaaaagttgtaactgggaaactcattgatattccaagtctcgtccga
aaagaaggaataaagaatccgggagtttttgctgtaggagatgttgtggcattaagggat
agattaaaatggtacgaaaacaaaaagctttttggaaaaaggattttgcttacaaggacc
tatgaacagtcacagcagatgaaaaaaattttgagcgaagagggagcagatgttgttgtt
tgtcctactattaaaatcacgccgtttttagataatatagtaaagtttttagaagaaata
cacaaattcgactatgctgtatttacaagtgtaaatggcgtttggagttttattgaagct
tccagagaaaaaaggtttgatttaagaaatttaagtattaaagtagtagcgatagggagt
aagactgcggaagctttagaaaatatttttatatatccagatataattcctgaggaatat
acttcatactctttggcaaatgcacttaaaaaacatgtggaaggaaaaaacatagcgctt
ttgacttcccagataggtggggatatattgctggaaagtctagggaattatgctaacgta
caaaaaattgtcgcatataaaaatgaaccaaattatgaaataaagggaaatcttataagt
gaactccgcaaaggagtagatattgctgtatttacaagttcctctacttttaattatatg
catcaattaataagagacgaaataaatcttttaaaaaactctaaaatagctgcaatagga
cctgtaacaaagaaagctatagaggataaaggatttaatgtagacataatgccaagtgaa
tacacaacggaaaaacttattgaagaaatattaaaaaatcatcagagtctataa

DBGET integrated database retrieval system