KEGG   Thermoanaerobacter italicus: Thit_0363Help
Entry
Thit_0363         CDS       T01178                                 

Definition
(GenBank) Porphobilinogen synthase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
tit  Thermoanaerobacter italicus
Pathway
tit00860  Porphyrin and chlorophyll metabolism
tit01100  Metabolic pathways
tit01110  Biosynthesis of secondary metabolites
tit01120  Microbial metabolism in diverse environments
Module
tit_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:tit00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Thit_0363
Enzymes [BR:tit01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Thit_0363
Exosome [BR:tit04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Thit_0363
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-ProteinID: ADD01678
JGI: Thit_0363
UniProt: D3T6R5
Position
407193..408167
Genome map
AA seq 324 aa AA seqDB search
MNLVKRPRRLRMNSILREMIRETSLDVGDLIYPLFVVPEDNIKEEIDSMPGVYHFSINLL
VEEVKEVRDLGIPAILLFGVPSYKDELGSEAYSEEGIVQKAVREIKEKVPEIVVITDVCM
CGYTTHGHCGIVENGQVLNDKTVDYIAKIALSHVEAGADIVAPSDMMDGRVAAIRKLLDS
KGFVNTPIMAYSAKYASSFYGPFREAANSFPQFGDRKSYQMDYGNSNEALREIALDIEEG
ADIVMVKPALSYLDIIRRVKDNFNIPIAAYNVSGEYSMVKAAAKMGWIDEKSVVLEILTS
IKRAGADMIITYFAKDVAKWLITL
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaatttggtaaaaaggccaagaaggcttaggatgaacagcattttaagggagatgata
cgagaaacttctttagatgtaggtgaccttatatatcctctttttgttgtgccagaagat
aatataaaagaagagatagattcaatgccaggtgtttatcatttttctataaatttgctt
gtagaagaagttaaagaagtgcgtgaccttggaattcctgctattttactttttggtgtg
ccttcatataaagatgaattggggtcagaggcttacagcgaggaaggtattgttcaaaaa
gccgtaagagaaataaaagaaaaagtgccagaaattgtggtaataacagatgtgtgtatg
tgtgggtatacaactcatggacactgtggcattgttgaaaatggccaagttctaaatgac
aaaacagtagactacattgctaaaatagcattgtcccatgttgaggcaggggcagatatt
gtagcgccttctgacatgatggatggaagagtagctgccataagaaagcttttagatagt
aaaggatttgtaaatacacctattatggcttacagtgctaaatacgcttcctctttttat
ggaccttttagagaagcagcaaattctttcccacaatttggcgatagaaagtcttatcaa
atggactatggaaattccaatgaagctttaagagaaatagctcttgacattgaagaagga
gcagatattgtcatggtaaaacctgcactttcttatcttgatattataaggcgggtaaag
gataatttcaatattcctattgctgcttacaatgtaagtggagaatattcaatggtaaag
gcggcagctaagatgggttggattgatgaaaaatcggtagtcttagaaatacttacttcg
attaaaagagcaggagcagatatgattataacttactttgcaaaggatgttgcaaaatgg
cttattaccctataa

DBGET integrated database retrieval system