KEGG   Thermoanaerobacter italicus: Thit_0412Help
Entry
Thit_0412         CDS       T01178                                 

Definition
(GenBank) peptidase M42 family protein
Organism
tit  Thermoanaerobacter italicus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M42 Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: ADD01719
JGI: Thit_0412
UniProt: D3T6Y7
Position
451683..452723
Genome map
AA seq 346 aa AA seqDB search
MDYKNLLKKLCESHGVSGHERGIYDLLKEEFATISDEVAEDKFGNLFFLKKGTKGKYKVM
LAAHLDEIGLIVKDIDDKGFIKFTTVGGVDQRTLPSQEVIVHGKKNILGVIGSKPPHLLS
SGDMEKAIKIEDMYIDVGMSKKEIEELIKIGDVITIKREFRELLNDYVSGKALDDRAGIA
VMAICLEELKKLYHYHDVYAVATLQEEVGLRGATTSAYNVEPDIAIAIDVTHGKARGVST
EIELARGPAIGKGPNIHPAVYKGLVDTAKEYNINHQIEPLPGPSGTDAWAIQISRGGVPT
GLVSIPLRYMHTSVETVNMKDIINSGKLLAYYIANLPEELEGQLCY
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggattataagaatttgctaaagaaattatgcgaaagccatggagtttctggacatgaa
agaggaatttatgatttattaaaagaagagtttgctacaatttctgatgaagtcgctgaa
gataaatttggcaatttattttttttaaaaaagggtacaaaaggtaagtataaggtaatg
ctggcagcccatttagatgaaataggtcttatagtaaaggatatagacgataagggattt
atcaagtttaccactgtagggggtgtagaccaaagaactcttccctctcaagaggtaata
gttcacggaaagaagaatatattgggagttatagggagcaaaccaccgcatcttttgtct
tcaggggatatggaaaaggctataaagattgaggacatgtacatagatgttggaatgagt
aaaaaagaaatagaggaattaattaaaattggagatgtaataactataaaaagagaattt
agagagcttctaaatgattatgtttcaggtaaagctttggacgacagggcaggcattgct
gtaatggcaatatgccttgaggagcttaagaaattataccattatcacgatgtttatgca
gtagcaacattgcaggaagaagtaggtctaagaggagctacaacttctgcttacaatgtt
gagccagatattgctattgctattgatgttacacatggtaaagcccgaggtgttagtaca
gagatagagctggctagaggtcctgctatagggaaaggtcctaatatacatccagctgta
tataaagggcttgtggatactgcaaaagagtacaatataaatcaccaaatagagccactt
cctggaccttcagggacagatgcatgggctatacagatttcaaggggaggagttccaaca
ggacttgtctcaatacctttaaggtacatgcatacatcagtggagactgttaatatgaag
gacatcataaatagtggaaagcttttggcctattatattgccaatcttccagaggaattg
gagggacaactatgttattaa

DBGET integrated database retrieval system