KEGG   Thermoanaerobacter italicus: Thit_0413Help
Entry
Thit_0413         CDS       T01178                                 

Definition
(GenBank) Cellulase
Organism
tit  Thermoanaerobacter italicus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
452714..453736
Genome map
AA seq 340 aa AA seqDB search
MLLKELTDLMGASGDEKEVREKIKEIVKPYVDELYVDKMGNLIACKKGKKEKPKVMLAAH
MDEVALMVKSINEDGTLSFSPVGGVDNRILVSKTVKVGEKRVNGVIGAKPIHLQKREEQQ
KPLDFDALYIDIGATSKEEALKHVSVGDYVYFDANFELLGNGYVKSKALDDRIGCNVLIE
ILKRDYEYPVCAAFTVQEEVGLRGAGVAAYNIEPDFAIVVEGTVAADVSDSEPHLVSTEL
GKGPAISLMDRTTLYDKKIINKIVKIAEENGVPYQFRRIASGGNDAGKIHLTKGGIKAIA
VSVPCRYIHSFNSVAFLEDFNNTVKLVDLIIKNIAKEALI
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgttattaaaagagctgacagatttgatgggtgcttcaggagatgaaaaagaagtaagg
gagaaaattaaagagattgtaaaaccttatgttgatgaactttatgtagacaaaatgggt
aatttaatagcctgcaaaaaagggaaaaaggaaaaacctaaagtgatgctggctgcccac
atggatgaagtagctttaatggtgaagtctataaacgaagacgggactttgagcttttca
cctgttgggggagtagacaaccgaatacttgtatctaaaactgtaaaagtgggcgaaaag
agggtaaatggcgtaataggtgctaagcctatacatcttcaaaaaagggaagagcagcag
aagcctcttgattttgatgcattgtacatagacataggggctacttcaaaggaagaggca
ttaaagcacgtttctgtaggggattatgtgtattttgatgccaactttgaattactggga
aatggatatgtaaaatcaaaggctttagatgacagaataggctgcaatgttttgatagag
atcttgaaaagggattatgaatatcctgtttgtgcagcttttactgtgcaggaagaggtt
ggtttaagaggagctggcgttgcagcctacaatatagagccggattttgctatagttgtg
gaaggcacagtggctgcggatgtttctgactcggaacctcatttggtttctaccgagtta
gggaaggggccggcaatttcattaatggacagaacgaccctttatgacaaaaagataatt
aacaagattgtaaaaatagcagaagaaaatggtgtgccttatcagtttagaaggatagcc
agtggtggcaatgatgcaggtaaaattcacctaacgaagggtggcataaaagcaattgct
gtatctgtcccctgtaggtatattcactcttttaattctgtagcctttttagaggatttt
aacaacacagtcaaattagttgatttgataataaagaatattgcgaaggaggctttgata
tga

DBGET integrated database retrieval system