KEGG   Thermoanaerobacter italicus: Thit_0413Help
Entry
Thit_0413         CDS       T01178                                 

Definition
cellulase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
tit  Thermoanaerobacter italicus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tit00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Thit_0413
Enzymes [BR:tit01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Thit_0413
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
452714..453736
Genome map
AA seq 340 aa AA seqDB search
MLLKELTDLMGASGDEKEVREKIKEIVKPYVDELYVDKMGNLIACKKGKKEKPKVMLAAH
MDEVALMVKSINEDGTLSFSPVGGVDNRILVSKTVKVGEKRVNGVIGAKPIHLQKREEQQ
KPLDFDALYIDIGATSKEEALKHVSVGDYVYFDANFELLGNGYVKSKALDDRIGCNVLIE
ILKRDYEYPVCAAFTVQEEVGLRGAGVAAYNIEPDFAIVVEGTVAADVSDSEPHLVSTEL
GKGPAISLMDRTTLYDKKIINKIVKIAEENGVPYQFRRIASGGNDAGKIHLTKGGIKAIA
VSVPCRYIHSFNSVAFLEDFNNTVKLVDLIIKNIAKEALI
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgttattaaaagagctgacagatttgatgggtgcttcaggagatgaaaaagaagtaagg
gagaaaattaaagagattgtaaaaccttatgttgatgaactttatgtagacaaaatgggt
aatttaatagcctgcaaaaaagggaaaaaggaaaaacctaaagtgatgctggctgcccac
atggatgaagtagctttaatggtgaagtctataaacgaagacgggactttgagcttttca
cctgttgggggagtagacaaccgaatacttgtatctaaaactgtaaaagtgggcgaaaag
agggtaaatggcgtaataggtgctaagcctatacatcttcaaaaaagggaagagcagcag
aagcctcttgattttgatgcattgtacatagacataggggctacttcaaaggaagaggca
ttaaagcacgtttctgtaggggattatgtgtattttgatgccaactttgaattactggga
aatggatatgtaaaatcaaaggctttagatgacagaataggctgcaatgttttgatagag
atcttgaaaagggattatgaatatcctgtttgtgcagcttttactgtgcaggaagaggtt
ggtttaagaggagctggcgttgcagcctacaatatagagccggattttgctatagttgtg
gaaggcacagtggctgcggatgtttctgactcggaacctcatttggtttctaccgagtta
gggaaggggccggcaatttcattaatggacagaacgaccctttatgacaaaaagataatt
aacaagattgtaaaaatagcagaagaaaatggtgtgccttatcagtttagaaggatagcc
agtggtggcaatgatgcaggtaaaattcacctaacgaagggtggcataaaagcaattgct
gtatctgtcccctgtaggtatattcactcttttaattctgtagcctttttagaggatttt
aacaacacagtcaaattagttgatttgataataaagaatattgcgaaggaggctttgata
tga

DBGET integrated database retrieval system