KEGG   Thermoanaerobacter italicus: Thit_0414Help
Entry
Thit_0414         CDS       T01178                                 

Definition
(GenBank) peptidase M42 family protein
Organism
tit  Thermoanaerobacter italicus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
453733..454716
Genome map
AA seq 327 aa AA seqDB search
MSLNIELIKKLTQTYGPSGSEEKVLQVIKEEVKNFCDEITYDALGNMICRKTGKGKKIMV
AAHTDEIGLMITHIEDEGFLRFTTIGGVSVEQIVGRRVVFKNGVQGAIGVEYLEDKKDFR
VEKLYIDIGAKNKEEAQKYVNIGDSASFAGEFIEAGDRLISKAFDDRIGCYVVIEALKNL
KTENEVYFVFTVQEEVGTRGAAAAAYNIHPDFAVAVDVTSTGDTPKAKKMAVSLGKGAAI
KVMDRSIIVSPSVREMMIEVAKENNIPYQLEILEFGGTDAGPIHLTKGGIPAGVISIPTR
YVHSISEMVDKNDIEASIELLKKVLEK
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgagcttaaatatagaattgataaaaaaacttacacagacttatggaccttcaggaagt
gaggagaaagttttacaggtcataaaagaggaagtaaaaaatttttgtgatgagattaca
tacgatgcattagggaatatgatatgcagaaaaacaggaaaaggaaaaaaaataatggtg
gctgctcatacagatgaaataggacttatgattacacacatagaagatgaaggtttcttg
aggtttactactatagggggagtttctgtagaacagatagtagggaggagagtggttttt
aaaaatggagttcaaggagccataggagtagaatatttagaggataaaaaagattttaga
gttgaaaaattgtatatagatattggggcaaaaaataaggaagaagctcaaaaatatgtc
aatattggagatagtgcatcttttgcaggtgaatttattgaagcaggtgatagacttata
tcaaaggcttttgatgataggataggatgctatgtagttattgaggcactaaaaaatctt
aaaacagaaaacgaagtgtattttgtgtttactgttcaagaagaagtggggacaagagga
gctgctgcagctgcctataacatacatcctgattttgctgtagcagttgatgttacatca
actggcgatacacctaaagcgaaaaagatggcagtctctcttggtaaaggggcagctata
aaagtgatggacaggtcaataatagtaagtccttctgtgagggagatgatgattgaggta
gcgaaagaaaataacattccttatcagttagaaatacttgaatttggtggaactgacgca
ggacctatacatttgacaaaaggtggtataccggcaggtgttatatcgattcctacaagg
tatgttcacagcatatcagagatggtagacaaaaatgacattgaggcaagtattgaactt
ttgaaaaaagttcttgaaaagtaa

DBGET integrated database retrieval system