KEGG   Thermoanaerobacter italicus: Thit_0575Help
Entry
Thit_0575         CDS       T01178                                 

Definition
phosphoribosylglycinamide formyltransferase
Orthology
K11175  
phosphoribosylglycinamide formyltransferase 1 [EC:2.1.2.2]
Organism
tit  Thermoanaerobacter italicus
Pathway
Purine metabolism
One carbon pool by folate
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:tit00230]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:tit00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
622333..622941
Genome map
AA seq 202 aa AA seqDB search
MNLVVMASGNGTDLQSIIDAIEEGYINARIIAVISDKKGAYALERAKKHGIATYCLPKKE
LKENFQEELLKLLEKLSPDGIILAGFLTILSGEIVERFENKIINIHPSLIPAFCGKGFYG
MKVHQAVYEYGVKYTGCTVHFVDQGADTGPIILQEVVKIDEEDTPETIAKKVLEVEHKVL
PYAVKLFTEGKLKVEGRKVRIL
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaaccttgtggtgatggcatcaggtaacgggactgatttgcagtcaataattgatgcc
attgaagaaggatatataaatgccaggataattgctgtcattagtgataaaaaaggagct
tatgctcttgaaagggcaaaaaaacacggaattgctacttactgcctccccaaaaaagaa
ttaaaagaaaattttcaggaagagttattaaaacttcttgaaaaattgagtcctgatgga
ataattcttgcaggttttttgacaattctcagtggagaaattgtagaaagatttgaaaac
aagataataaatatacatccctcacttattcctgccttttgtggcaaaggattttatgga
atgaaggtacatcaggcggtttatgaatacggagtaaaatacaccggctgtacagtgcac
tttgttgaccagggagcagataccggcccaattattcttcaagaagtcgtgaaaattgat
gaagaagatacgccagagactattgcaaaaaaagtgctggaagtagaacacaaggtttta
ccttatgcagttaagctttttacggaggggaaattaaaagtcgaaggaaggaaagtaagg
atattatag

DBGET integrated database retrieval system