KEGG   Thermoanaerobacter italicus: Thit_0655Help
Entry
Thit_0655         CDS       T01178                                 

Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
tit  Thermoanaerobacter italicus
Pathway
tit00521  Streptomycin biosynthesis
tit00523  Polyketide sugar unit biosynthesis
tit01130  Biosynthesis of antibiotics
Module
tit_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:tit00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Thit_0655
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Thit_0655
Enzymes [BR:tit01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Thit_0655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-ProteinID: ADD01954
JGI: Thit_0655
UniProt: D3T7M2
Position
711037..711588
Genome map
AA seq 183 aa AA seqDB search
MGKFKFIETEIEGLYIIETGVFEDNRGYFMESYNYKDFKAAGIDAVFVQDNQSKSKKGVL
RGLHFQKKHPQGKLVRVLKGEVFDVAVDLRKNSKTYGKWVGVILSDKNKRQFYIPEGFAH
GFLVLSDEAEFFYKCTDFYYPDDEGGIIWNDPDINIQWPLEGIEEVILSEKDKKWPRLRD
LAF
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgggaaagtttaagttcatagaaacagaaatagaaggactgtacataatagagacggga
gtttttgaagataacagaggatattttatggaatcgtacaattacaaagatttcaaagct
gcagggattgatgcagtatttgtccaggataatcaatcaaaatccaaaaaaggtgtttta
aggggattgcattttcagaaaaaacatccgcagggcaaactggtgagagttttaaaggga
gaggtttttgatgtagcagttgatttaagaaaaaactccaaaacttatggtaaatgggta
ggggttattttgtctgacaaaaacaaaaggcagttttatattccagagggatttgcccat
ggttttttagttttatcagatgaagctgagtttttttataaatgtaccgatttttattat
cctgacgatgagggcgggataatatggaatgatcctgatataaatatacaatggccattg
gaagggattgaagaagtaattttatctgaaaaggataaaaaatggccaaggttaagagat
ttagcgttttaa

DBGET integrated database retrieval system