KEGG   Thermoanaerobacter italicus: Thit_0715Help
Entry
Thit_0715         CDS       T01178                                 

Definition
(RefSeq) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
tit  Thermoanaerobacter italicus
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tit00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Thit_0715
   00052 Galactose metabolism
    Thit_0715
   00500 Starch and sucrose metabolism
    Thit_0715
   00520 Amino sugar and nucleotide sugar metabolism
    Thit_0715
Enzymes [BR:tit01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Thit_0715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
779207..780121
Genome map
AA seq 304 aa AA seqDB search
MKIRKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIVEEAIQSGIEDILIITGRNK
RAIEDHFDKSVELELELKKKKKENLLHLVEDITNMVDIHYIRQKEPKGLGHAIYCARAFV
GNEPFAVLLGDDIVDAEVPVLKQMIEQYERYNCTIIGVQQVPYEDVDKYGIVDSTPIEDR
LYKVNNLVEKPKKEETPSNIAILGRYIITPRIFEILENTPPGAGGEIQLTDALKTLLNYE
AIYAYDFIGKRYDVGDKLGYLMATVEYALKREDLREPFKRYLLEVARNLDPVGEEAAPTI
TQEV
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaataaggaaggcgataattccggctgcaggccttggtaccaggtttttacctgct
accaaagcccagcctaaagaaatgcttccaattgtggacaaacccactattcagtacata
gttgaagaagcaatacagtctggaattgaagatatacttataataactgggaggaataaa
agagcgatagaagaccattttgataaatcagtagagttggagctggagttaaaaaagaaa
aagaaagaaaaccttttgcatcttgtggaagacattactaatatggtagatattcattac
attaggcaaaaagaaccaaaaggtttaggtcatgccatatactgtgcgagagcttttgtg
ggaaatgagccctttgctgttcttttgggggatgacatagtagatgctgaagttcctgtt
ttgaagcagatgattgaacaatacgaaaggtacaactgcactattattggagtgcaacaa
gtgccgtatgaggatgtagataaatacggtattgttgattctacacctattgaggacaga
ttgtacaaagtgaataatctcgtagaaaagcctaaaaaagaagaaacaccatcaaatata
gctattctgggaagatatataataacgccaagaatatttgaaatattggaaaacacgcca
ccaggagcaggaggtgagatacagcttacggatgctttaaaaactcttttaaattatgaa
gcaatttacgcctatgattttattggcaaaagatatgatgtgggagataaattaggttac
cttatggcaactgttgagtatgctctaaaaagagaagacttaagagaaccttttaagaga
tatttattggaagttgcaagaaatttagatccggtgggagaagaagctgcaccaacaatt
acacaagaagtttaa

DBGET integrated database retrieval system