KEGG   Thermoanaerobacter italicus: Thit_0715Help
Entry
Thit_0715         CDS       T01178                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
tit  Thermoanaerobacter italicus
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tit00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Thit_0715
   00052 Galactose metabolism
    Thit_0715
   00500 Starch and sucrose metabolism
    Thit_0715
   00520 Amino sugar and nucleotide sugar metabolism
    Thit_0715
Enzymes [BR:tit01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Thit_0715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
779207..780121
Genome map
AA seq 304 aa AA seqDB search
MKIRKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIVEEAIQSGIEDILIITGRNK
RAIEDHFDKSVELELELKKKKKENLLHLVEDITNMVDIHYIRQKEPKGLGHAIYCARAFV
GNEPFAVLLGDDIVDAEVPVLKQMIEQYERYNCTIIGVQQVPYEDVDKYGIVDSTPIEDR
LYKVNNLVEKPKKEETPSNIAILGRYIITPRIFEILENTPPGAGGEIQLTDALKTLLNYE
AIYAYDFIGKRYDVGDKLGYLMATVEYALKREDLREPFKRYLLEVARNLDPVGEEAAPTI
TQEV
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaataaggaaggcgataattccggctgcaggccttggtaccaggtttttacctgct
accaaagcccagcctaaagaaatgcttccaattgtggacaaacccactattcagtacata
gttgaagaagcaatacagtctggaattgaagatatacttataataactgggaggaataaa
agagcgatagaagaccattttgataaatcagtagagttggagctggagttaaaaaagaaa
aagaaagaaaaccttttgcatcttgtggaagacattactaatatggtagatattcattac
attaggcaaaaagaaccaaaaggtttaggtcatgccatatactgtgcgagagcttttgtg
ggaaatgagccctttgctgttcttttgggggatgacatagtagatgctgaagttcctgtt
ttgaagcagatgattgaacaatacgaaaggtacaactgcactattattggagtgcaacaa
gtgccgtatgaggatgtagataaatacggtattgttgattctacacctattgaggacaga
ttgtacaaagtgaataatctcgtagaaaagcctaaaaaagaagaaacaccatcaaatata
gctattctgggaagatatataataacgccaagaatatttgaaatattggaaaacacgcca
ccaggagcaggaggtgagatacagcttacggatgctttaaaaactcttttaaattatgaa
gcaatttacgcctatgattttattggcaaaagatatgatgtgggagataaattaggttac
cttatggcaactgttgagtatgctctaaaaagagaagacttaagagaaccttttaagaga
tatttattggaagttgcaagaaatttagatccggtgggagaagaagctgcaccaacaatt
acacaagaagtttaa

DBGET integrated database retrieval system