KEGG   Thermoanaerobacter italicus: Thit_0863Help
Entry
Thit_0863         CDS       T01178                                 

Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
tit  Thermoanaerobacter italicus
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tit00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Thit_0863
Enzymes [BR:tit01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Thit_0863
Peptidases [BR:tit01002]
 Cysteine Peptidases
  Family C44
   Thit_0863
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
922294..923805
Genome map
AA seq 503 aa AA seqDB search
MCGLAGIIGTGDKSKIKRMLDKIRHRGPDESGIFADENITLGHNRLTIIDLYHGRQPIKN
EDGRYWLIYNGEIYNYQLLRKELKNHTFSTDTDSEVIIHLYEELGKNCVNYIDGMFALAI
YDSKKKTIFIARDPLGIKPLYYGKTKEGYFAFASEIKALQEVTDDINEFPNGYIYTTENG
FEKYYTIPQDPMHFADVNNIINGLRLRLEDSVRKRLIADVPVGVFLSGGLDSSLIAAIAA
KYKNPLHSFAVGVEGSNDLKNARVVADYVGTIHHEFIYTEEDIKKILPEVIYYLESCDPA
LVRSAVATYFVAKLASNYVKVILSGEGADELFSGYHYLKNYTSPWKLQSELKYITRNLHN
TNLQRVDRMTMAHSIEGRVPFLDVEVLRYAFKITPSFKINGREKTEKWILRKLAENYLPE
SIVWRRKEKFAIGSGTSEILNKIAESEISDAEYIKNRFLSNGFEIKSKEELYYFKILKRF
FNVDSFIKDMGRSRSLNDNQIYA
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggattagcaggaattataggaactggtgataagagtaaaataaaaaggatgctt
gataaaatacgacatcgtggcccggatgagtcagggatttttgcagatgaaaatattaca
ttaggccataataggctgacgataattgacctttatcatggacgtcaacctataaaaaac
gaagatggtaggtattggcttatttataatggagaaatttacaattaccaattattgcgt
aaagagttaaaaaaccatactttttccacagatactgatagcgaagtaataattcatttg
tatgaagaactaggtaaaaattgtgttaactatattgatggaatgtttgctttagctatt
tatgactctaaaaaaaagaccatatttattgctcgtgatcctttaggaataaagccattg
tattatggcaaaacaaaagaagggtattttgcctttgcttcggagattaaagcacttcag
gaagtaactgatgatataaatgaatttcctaatggatatatttatacaactgaaaacgga
tttgagaaatattatacaattccacaggatccgatgcattttgcagatgttaataatatt
attaatggattaaggcttagattagaggattcagtaagaaaaaggttgattgctgatgtg
cctgttggagtatttttaagtggcggattggatagcagccttatcgcagcgatagcagca
aaatacaaaaacccccttcattcatttgcagtaggtgtcgaaggaagtaatgacttaaag
aacgcaagagttgttgctgattatgtggggacgattcaccatgaatttatttatacagag
gaggacataaaaaaaattttacccgaagttatatattatcttgaatcctgtgatccagcc
ttagtcagaagtgctgttgcaacatattttgtagcaaaacttgcaagcaattacgtaaaa
gttattctttcgggagaaggtgctgatgaattgtttagtggataccattaccttaaaaat
tataccagtccttggaaattacaatccgaattaaaatatataactcgaaatttgcataat
acaaatcttcaaagagttgacagaatgacaatggcacattccattgaaggacgtgtaccg
tttttagatgtagaagtgttacggtacgcgtttaaaataacgccatcatttaaaattaac
ggccgagaaaaaaccgaaaagtggatacttagaaaacttgcagaaaattacttaccagag
tcaattgtatggagaagaaaagaaaaatttgcaataggaagtggtacatctgaaatatta
aataagatagcagaatcagaaattagtgatgcagagtatataaaaaatagattcctttct
aacggttttgaaataaagtcaaaggaagagctgtattattttaaaattttaaaaagattt
tttaatgttgattcttttataaaggacatgggaagaagtagaagtctcaatgacaaccaa
atatatgcataa

DBGET integrated database retrieval system