KEGG   Thermoanaerobacter italicus: Thit_0906Help
Entry
Thit_0906         CDS       T01178                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
tit  Thermoanaerobacter italicus
Pathway
tit00040  Pentose and glucuronate interconversions
tit00052  Galactose metabolism
tit00500  Starch and sucrose metabolism
tit00520  Amino sugar and nucleotide sugar metabolism
tit01100  Metabolic pathways
tit01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tit00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Thit_0906
   00052 Galactose metabolism
    Thit_0906
   00500 Starch and sucrose metabolism
    Thit_0906
   00520 Amino sugar and nucleotide sugar metabolism
    Thit_0906
Enzymes [BR:tit01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Thit_0906
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD CTP_transf_3 RecG_N
Motif
Other DBs
NCBI-ProteinID: ADD02184
JGI: Thit_0906
UniProt: D3T8A2
Position
965089..965967
Genome map
AA seq 292 aa AA seqDB search
MEIKKAVIPAAGLGTRFLPITKTIPKEMLPIVDKPVIHYVVEEAVNSGIKEILIITNKNK
KAIEDYFDKFDEIENEIKKSNKEELLPLIRDTCNLADIYYVRQKELKGLGHAISCAKAFV
GNQPFAVLLGDDLVDSKVPCLKQLINCYSKYNSPILGVQAIDKKDVVKYGIIDGIPLEDG
TYKIKSMVEKPKVSEAPSNIAVLGRYILTPQIFDILEKTEPGKNGEVQLTDALKVLAQQR
PIYAYHFEGKRYDIGDKFGFLQANIDYALKRKELRKSLIIYLQAVLKNLNKV
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atggaaataaaaaaggctgttattcctgcagctggattaggaaccagattcctgccaatt
acaaaaactatacccaaggaaatgctacctattgtggataaacctgttatacattatgtt
gtggaggaggctgttaattctggcatcaaagagatattgataattactaacaaaaacaaa
aaagctatagaagattactttgacaagtttgatgaaattgaaaatgaaattaaaaaaagt
aacaaagaagagttattaccattaatacgggatacatgcaatttggctgatatttattat
gtaaggcaaaaagaacttaaaggattgggacatgcaataagttgtgcaaaagcttttgtt
ggtaaccaaccttttgcagttttgttgggtgatgaccttgttgacagcaaggtcccctgc
cttaaacaattgataaactgctattctaaatacaattcacctattttaggagtgcaagct
attgataaaaaggatgttgtaaaatatggaattatagatggtataccacttgaggacgga
acttacaaaattaaaagcatggtagaaaaacctaaagtcagtgaagctccatcgaatatt
gctgtcttgggcagatatatactaactcctcagatatttgatatacttgaaaaaaccgaa
cctgggaagaatggagaggtacagcttacagatgcgttaaaagtattagcacagcagcga
ccaatatatgcttatcactttgaaggaaaaagatatgacattggggacaagtttgggttt
cttcaggctaatatagattatgcattaaagcgcaaagagttgagaaaaagccttataata
tatcttcaagctgttttgaaaaatcttaataaggtatag

DBGET integrated database retrieval system