KEGG   Thermoanaerobacter italicus: Thit_1130Help
Entry
Thit_1130         CDS       T01178                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
tit  Thermoanaerobacter italicus
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tit00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Thit_1130
Enzymes [BR:tit01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Thit_1130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1166378..1167244
Genome map
AA seq 288 aa AA seqDB search
MIEGKSLVNPGKFLGAIGEYEKANVVIVGLPMDYTVSFKAGSRFGPASIRQASYGLECYS
VYLDRRLEDKKYYDLGDLVLPYGNVEKSLDLISKTTENILKSGKKGIFLGGEHLVTYGIL
KEYLKKYGDNLVILHFDAHTDLREEFFGEPYSHATVMKRVWDIANGAKMYSFGIRSGEKE
EFEFAKKNIHMFLYDVVEPLKKLINDIKDYPIYISLDIDVIDPAFAPGTGTPEPGGITIK
EALEVIHILKDLNVVGMDLVEVSPSHDIAGITSILAAKIIRESILSFF
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgatagaagggaaatctcttgtcaatccgggaaagtttttaggggctattggagaatat
gaaaaggcaaatgtagttatagtaggtttgcctatggattacacagtgagtttcaaggca
ggaagccgctttggacctgcttcgataaggcaagcttcttatggtttagaatgttacagc
gtatatttagatagaagattggaagataagaaatattatgatttgggagatttagtactt
ccttatggaaatgtggaaaagagtttagatttaatctcaaaaactacagaaaacatttta
aaaagtggaaaaaaaggaatattcttgggtggagaacatttagtgacttatggaatttta
aaagagtacttaaaaaaatatggagataaccttgtaattcttcattttgatgcccatact
gatttaagagaagaattttttggtgaaccttattctcacgccacagtcatgaaaagagtg
tgggacattgcgaatggtgctaaaatgtatagttttggaataaggtcaggggaaaaggaa
gaatttgaatttgccaaaaaaaatatccatatgtttttgtacgatgtagttgaacctttg
aaaaagttaattaatgatataaaagattatccaatttatattagtttggatatagatgtt
atagaccctgcttttgcaccaggcactggtacaccagaaccagggggaataactataaaa
gaggcattagaggtaattcatattttaaaagatttaaatgtagtcggcatggatttagta
gaagtctcgccttcccatgatatagctggtataacctctattttagcagctaagattata
agggaatctattctttctttcttttaa

DBGET integrated database retrieval system