KEGG   Thermoanaerobacter italicus: Thit_1424Help
Entry
Thit_1424         CDS       T01178                                 

Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
tit  Thermoanaerobacter italicus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tit00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Thit_1424
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Thit_1424
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Thit_1424
Enzymes [BR:tit01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Thit_1424
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1439654..1440442)
Genome map
AA seq 262 aa AA seqDB search
MNRIDKKFEDLKKEGRKALITFITAGDPDIETTYDIVLALEEGGADIIELGIPYSDPLAD
GPTIQASSQRALNKGIKIPDIMKIVEKIRLKSDIPLVYLVYYNSIFKYGIQKFLEESKKA
GVDGLIIPDLPLEERKDILEEADKYGIYLIPLVAPTSKERIKLITENGKGFVYCVSITGV
TGARENIETDIEEYMKTVSQYTNMPKAIGFGISTPEMAKKLKDFSDGIIVGSAIVERIAK
GYNKSEILKEVKSFISSLKEVL
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaataggattgacaaaaaatttgaagatttaaaaaaagaaggacgtaaagccttaata
acctttataacagcgggagacccagatattgagaccacttatgatatagttttggcttta
gaagaaggaggagcagatataattgaacttggaataccttattctgaccccttagctgat
ggtcctacaatacaggcatcctctcaaagagctttaaataaaggtataaaaattcctgat
ataatgaaaatagtagaaaaaataagattaaaaagtgatattccattggtgtaccttgtg
tactataactctatattcaaatatggcatacaaaagtttttggaagagtcgaaaaaagca
ggagtagatggacttatcattccagatttgcctcttgaagaaagaaaagatattttagaa
gaagcagataaatacggtatttatttgatacctttagttgcgcccacatcaaaagaaaga
ataaagttaattactgaaaatggcaaaggatttgtatattgcgtttcaattacaggtgtg
acaggtgcgagggaaaatattgaaactgatattgaagaatatatgaagactgtctctcaa
tacactaatatgccaaaggcgatagggtttggcatatctactccagagatggcgaaaaaa
ttaaaagatttcagtgatgggattattgtaggaagcgccattgtagaaagaattgctaaa
gggtataataaatctgaaatacttaaggaagttaagagttttatatccagcttaaaagaa
gttttatga

DBGET integrated database retrieval system