KEGG   Thermoanaerobacter italicus: Thit_1424Help
Entry
Thit_1424         CDS       T01178                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
tit  Thermoanaerobacter italicus
Pathway
tit00260  Glycine, serine and threonine metabolism
tit00400  Phenylalanine, tyrosine and tryptophan biosynthesis
tit01100  Metabolic pathways
tit01110  Biosynthesis of secondary metabolites
tit01130  Biosynthesis of antibiotics
tit01230  Biosynthesis of amino acids
Module
tit_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tit00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Thit_1424
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Thit_1424
Enzymes [BR:tit01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Thit_1424
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA PcrB His_biosynth BtpA
Motif
Other DBs
NCBI-ProteinID: ADD02680
JGI: Thit_1424
UniProt: D3T378
Position
complement(1439654..1440442)
Genome map
AA seq 262 aa AA seqDB search
MNRIDKKFEDLKKEGRKALITFITAGDPDIETTYDIVLALEEGGADIIELGIPYSDPLAD
GPTIQASSQRALNKGIKIPDIMKIVEKIRLKSDIPLVYLVYYNSIFKYGIQKFLEESKKA
GVDGLIIPDLPLEERKDILEEADKYGIYLIPLVAPTSKERIKLITENGKGFVYCVSITGV
TGARENIETDIEEYMKTVSQYTNMPKAIGFGISTPEMAKKLKDFSDGIIVGSAIVERIAK
GYNKSEILKEVKSFISSLKEVL
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaataggattgacaaaaaatttgaagatttaaaaaaagaaggacgtaaagccttaata
acctttataacagcgggagacccagatattgagaccacttatgatatagttttggcttta
gaagaaggaggagcagatataattgaacttggaataccttattctgaccccttagctgat
ggtcctacaatacaggcatcctctcaaagagctttaaataaaggtataaaaattcctgat
ataatgaaaatagtagaaaaaataagattaaaaagtgatattccattggtgtaccttgtg
tactataactctatattcaaatatggcatacaaaagtttttggaagagtcgaaaaaagca
ggagtagatggacttatcattccagatttgcctcttgaagaaagaaaagatattttagaa
gaagcagataaatacggtatttatttgatacctttagttgcgcccacatcaaaagaaaga
ataaagttaattactgaaaatggcaaaggatttgtatattgcgtttcaattacaggtgtg
acaggtgcgagggaaaatattgaaactgatattgaagaatatatgaagactgtctctcaa
tacactaatatgccaaaggcgatagggtttggcatatctactccagagatggcgaaaaaa
ttaaaagatttcagtgatgggattattgtaggaagcgccattgtagaaagaattgctaaa
gggtataataaatctgaaatacttaaggaagttaagagttttatatccagcttaaaagaa
gttttatga

DBGET integrated database retrieval system