KEGG   Thermoanaerobacter italicus: Thit_1425Help
Entry
Thit_1425         CDS       T01178                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
tit  Thermoanaerobacter italicus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tit00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Thit_1425
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Thit_1425
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Thit_1425
Enzymes [BR:tit01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Thit_1425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1440439..1441614)
Genome map
AA seq 391 aa AA seqDB search
MSGRFGRFGGQYVPETVMNALIELEREFEKAKQDKDFMEEYRYYLREYSGRPTPLYYAEN
LTKKLGGAKIYLKREDLNHTGAHKINNVLGQILLAKRMNKKRVIAETGAGQHGVATATAA
AMFGMECEIFMGEEDIKRQSLNVFRMKLLGAKVTPVKSGTGTLKDAVNEAIRDWVTNVDS
TFYVIGSVVGPHPYPTMVRDFQRVIGDEAKEQILQKEGRLPDYVIACVGGGSNAMGIFYP
FIEDKEVKLIGVEAAGEGIETGKHAATMAKGSVGVLHGMMTYLLQDEEGRIMPVYSISAG
LDYPGVGPEHAFLKESNRAQYVYATDEEALAAFMDLSQTEGIIPALESAHALAYAMKLAP
NLSEDNIIIVNLSGRGDKDVNTVAKVMGVEL
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgagtggaagatttggacgttttggaggccagtatgtgccagagactgtgatgaatgcg
cttatagaattagagagggaatttgaaaaagctaaacaggataaagatttcatggaagaa
tataggtattacttgagagaatattcaggaaggcctacacctttgtattatgctgagaat
cttactaaaaagctgggtggggcaaagatttatctaaagagggaagacctaaaccacaca
ggagcccataaaataaacaacgtattgggacagattttattggcaaagcggatgaataaa
aagagagttatagctgagacaggggcaggacagcatggagtggcaactgctacagctgct
gcaatgtttggaatggaatgcgaaatattcatgggagaagaagatataaaaaggcaatct
ttaaatgtctttagaatgaaacttttaggtgcaaaagtaacaccagtaaaatcagggacg
ggtaccttaaaagatgcagtaaatgaagcgataagggattgggtgacaaatgtagatagt
actttttacgtgataggttctgttgttggtcctcatccttatcctactatggtgagagat
tttcaaagagtgataggtgatgaggcaaaagagcaaatacttcaaaaagaaggaagactt
cctgactatgtgattgcttgtgtcggcggaggcagcaatgccatgggaattttctatccc
tttattgaagataaagaggtaaaattgataggtgtagaagcagcaggagaagggattgag
acagggaaacatgcagctacaatggcgaaaggttctgtaggagtattgcatggcatgatg
acttatcttttacaggatgaagaggggagaataatgccggtatattctatatctgcggga
ctggattacccaggtgtaggtccagaacatgcgtttttaaaagaaagtaatagagctcaa
tatgtatatgcgacagacgaagaagcattggcggcttttatggatttatctcaaacagaa
gggataataccagctttggaaagcgctcacgctttggcatatgctatgaaactagctcca
aatttaagtgaagacaatattatcattgtaaatttgtcaggcagaggagataaagacgta
aatacagttgccaaagtaatgggggtggagttatga

DBGET integrated database retrieval system