KEGG   Thermoanaerobacter italicus: Thit_1427Help
Entry
Thit_1427         CDS       T01178                                 

Definition
indole-3-glycerol-phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
tit  Thermoanaerobacter italicus
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tit00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Thit_1427
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Thit_1427
Enzymes [BR:tit01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Thit_1427
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1442224..1443006)
Genome map
AA seq 260 aa AA seqDB search
MVLDEIVRHKKKEVEEKKRIKPVEELINEIKGGYSGSFKKALQKEGISIIGEIKKASPSK
GIIKEDFDAVKIAKVYEKVDIDAISVLTEKEFFKGDDNYISEVKKVTSKPILRKDFIVDE
YQIYESKILGADAVLLIVSILGDKLRDFYNLSKSVGLDALVEVHDRQQLAIALEAECDII
GINNRDLKTFNVDITTTENLIKYIPQNTIIVSESGIKTPEDIKCLASLGVDAVLIGETFM
KIIDDIDKITNFVRETKGGG
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggtattagatgagattgtgagacacaaaaaaaaggaggtggaagagaaaaaaagaata
aagccagtagaggaactaattaacgaaattaaaggaggctattctggcagtttcaagaaa
gcacttcaaaaagagggtatatcaattattggagagataaaaaaagcctctccctctaaa
ggtattataaaagaagactttgatgcagtaaaaattgcaaaagtgtatgagaaagttgat
attgacgctatttccgttttgacagagaaggaattttttaaaggggatgacaattacatt
agtgaagtaaaaaaagtcacttcaaaacctattttgagaaaagattttattgtggatgaa
taccaaatatatgaatcaaaaattttaggagccgacgcagtacttctcattgtttccata
ttaggggacaaattaagagatttttataatttatctaaaagtgtaggtttagatgcgctt
gtggaagttcacgatagacagcagcttgcaatagcattagaagctgaatgtgacataata
ggtataaataacagagacctcaaaacttttaatgtagatataactacaacagaaaattta
attaaatatattcctcaaaatacaataattgtttctgaaagtggaataaaaacgccggaa
gatataaagtgtttggcttcattgggagtagatgctgtattgattggcgagacttttatg
aaaattatagatgatattgacaaaatcactaattttgtaagggagacaaaaggaggagga
taa

DBGET integrated database retrieval system