KEGG   Thermoanaerobacter italicus: Thit_1435Help
Entry
Thit_1435         CDS       T01178                                 

Definition
(GenBank) class II aldolase/adducin family protein
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
tit  Thermoanaerobacter italicus
Pathway
tit00051  Fructose and mannose metabolism
tit01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:tit00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Thit_1435
Enzymes [BR:tit01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Thit_1435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: ADD02691
JGI: Thit_1435
UniProt: D3T389
Position
complement(1449992..1450639)
Genome map
AA seq 215 aa AA seqDB search
MLMQSEREQIVEYGKKLITSNLTRGTGGNLSIYNREKGLMAITPSGMDYFKIRSEDVVVM
DLNGKIVEGDKPPSSEYEMHRIFYANRQDINAIIHTHPVYTTTLACLNWDLPPVHYLVAL
AGPNVRCAKYATFGTKELAENAFEAMKDRKAVLLANHGLLVGAEDLPNAFNISEQIEYVA
ELYYRAKSIGEPVILSENEINLMLEKFKTYGQVKK
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
ttgctaatgcaatcagaaagggaacaaatagtagaatatgggaaaaaactcataacttct
aatctcactagaggtacaggaggaaacttaagtatttataatcgagaaaaaggtttgatg
gctataactccttctggaatggattattttaaaatccggtcagaggatgtcgtagtaatg
gatttaaatgggaaaatagtagagggcgataaaccgccttcttcagaatatgaaatgcac
agaattttttatgctaacagacaagatataaatgcaattatacatacccatccagtatat
actactactcttgcatgtttaaattgggaccttccaccagttcactatttagtagcttta
gctggaccaaatgtgagatgtgcaaaatatgcgacttttggcactaaagaattagcggaa
aatgcttttgaagcaatgaaggacagaaaagctgttttattagctaatcatggattacta
gtgggagccgaagacctgccaaatgcttttaatataagtgagcagattgaatatgttgcg
gagttgtactatagagcaaagtccataggagaaccggtaattctttctgaaaatgagata
aatttgatgttagaaaaatttaaaacttatggacaagttaaaaaataa

DBGET integrated database retrieval system