KEGG   Thermoanaerobacter italicus: Thit_1540Help
Entry
Thit_1540         CDS       T01178                                 

Definition
(GenBank) dipeptidase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
tit  Thermoanaerobacter italicus
Pathway
tit00300  Lysine biosynthesis
tit01100  Metabolic pathways
tit01120  Microbial metabolism in diverse environments
tit01230  Biosynthesis of amino acids
Module
tit_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:tit00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Thit_1540
Enzymes [BR:tit01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Thit_1540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: ADD02795
JGI: Thit_1540
UniProt: D3T3J3
Position
complement(1551171..1552565)
Genome map
AA seq 464 aa AA seqDB search
MDLNSYIDDMRDDIIKSVQELVRIKSVQDEPKPGMPYGEGIAKALDKALEIAQSLGFKTK
NVDGHVGYAEYGEGEEMIGVLGHLDVVPEGEGWTYPPYGAEIHEGKIYGRGTVDDKGPII
AALYGLKAIKDAGLKLSKRVRILFGTNEENGSHEIPYYLKHDEAPTMGFTPDAQYPIIYA
EKGITMFDVVKEFNKKPSNIVIKYIKGGERPNVVPGYCEAGLDVKEANKKKEIQDKLEAF
VKETGYNLKAEEKDEMLVIKSVGVSAHGSLPHLGKNAIMQLFLFLDRIDLEDSDVKDFIH
FFATNVGMETGGKTFGIYLKDETGELTFNVGTIQLDESKGVLGLNIRYPVKYKYEDWMNI
FEEKIKTTGMRIEDMLHQPPLYFPPDHPLIKTLSKVYEEQMGQKAELLAIGGGTYAKEMP
NTVAFGPVFPGKPELAHQADEYIEIEDLILNAKIYAHAIYELAK
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atggatttaaattcctacatagatgatatgagagatgacattataaaatctgttcaagaa
ttagttaggataaaaagtgtacaagatgaaccgaaaccaggaatgccttatggagaaggt
attgccaaagcgttagataaagctttagagattgcacaaagtttaggctttaaaactaaa
aatgtagatggccatgtaggatatgcagaatacggcgaaggagaagaaatgataggagtt
ttgggacatttagatgtggttccagaaggtgaggggtggacttatcccccttatggtgct
gaaatccatgagggaaagatatatggaagaggtactgtagatgataaaggcccaataatt
gcggctttatatggcttaaaagctataaaagatgcgggattaaaactttcgaagagagta
aggattttatttggaacaaatgaagagaatggttctcacgaaattccttattatttaaaa
cacgatgaagcgcctacaatgggctttactccagatgcccaatatccaattatatatgca
gaaaaaggtataacaatgtttgatgtagttaaagagtttaataaaaagcccagtaatata
gttataaaatacatcaaaggtggagaaaggcctaatgtagtaccaggctattgtgaagct
ggattagatgtaaaagaggcaaataagaagaaagaaattcaagataagttagaagctttc
gtaaaagagactggttataatttgaaggctgaagaaaaagacgaaatgcttgtaatcaaa
tcggtaggggtttcggctcatggcagtcttccgcatttaggaaaaaatgctataatgcag
ttatttctcttccttgacagaatagatttagaggatagcgatgtcaaagattttatacat
ttctttgctacaaatgtggggatggaaacaggtggaaaaacttttgggatatacttaaaa
gatgaaacaggagaattgacttttaacgttggcactattcaattggatgaaagcaaagga
gtgttaggtttaaatatcagatatcctgtaaaatataaatatgaggattggatgaatatt
tttgaagaaaaaatcaaaactactgggatgagaatagaagacatgctccatcaaccacct
ttgtatttcccaccagaccatcctttgataaaaactttgagcaaagtttatgaagaacag
atgggacagaaagcagagcttttagcaataggtggaggaacttatgcgaaagaaatgcct
aacacagtagcatttgggcctgtttttccaggcaagccagagttagcacatcaagcggat
gaatatatagaaattgaagatttgatattaaatgcaaaaatttatgctcacgctatatat
gaattagcaaaataa

DBGET integrated database retrieval system