KEGG   Thermoanaerobacter italicus: Thit_1630Help
Entry
Thit_1630         CDS       T01178                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
tit  Thermoanaerobacter italicus
Pathway
tit00010  Glycolysis / Gluconeogenesis
tit00030  Pentose phosphate pathway
tit00051  Fructose and mannose metabolism
tit00052  Galactose metabolism
tit00680  Methane metabolism
tit01100  Metabolic pathways
tit01110  Biosynthesis of secondary metabolites
tit01120  Microbial metabolism in diverse environments
tit01130  Biosynthesis of antibiotics
tit01200  Carbon metabolism
tit01230  Biosynthesis of amino acids
tit03018  RNA degradation
Module
tit_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tit00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Thit_1630
   00030 Pentose phosphate pathway
    Thit_1630
   00051 Fructose and mannose metabolism
    Thit_1630
   00052 Galactose metabolism
    Thit_1630
  Energy metabolism
   00680 Methane metabolism
    Thit_1630
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Thit_1630
Enzymes [BR:tit01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Thit_1630
Protein phosphatases and associated proteins [BR:tit01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Thit_1630
Messenger RNA biogenesis [BR:tit03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Thit_1630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK Peripla_BP_1 DAGK_cat NAD_kinase
Motif
Other DBs
NCBI-ProteinID: ADD02881
JGI: Thit_1630
UniProt: D3T3S9
Position
complement(1643397..1644362)
Genome map
AA seq 321 aa AA seqDB search
MKTIGILTSGGDAPGMNAAIRAVVRTGIYYGLKVKGIMRGYAGLVEDEVIDLNLSSVGDI
LQKGGTILRTARCEEFKKKEVRKKAYETLQKHGIEGLVIIGGDGSFRGAQLLSEEWNVNT
IGIPGTIDNDIPCTDYTIGFDTACNTVIDAINKIRDTATSHERANIIEVMGRNAGYIALY
AGLAGGAEMIILPEVEWSIDELCDKITYGIKRGKLHHIIVLAEGVMSAPELAKMIKERLP
KLDLRYTILGHIQRGGAPTVMDRVLASQMGARAVELLLENKTKRIISIRNNQIVDDDIDE
ALSMKKEFNRKLYELSKILSI
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgaagacaattgggatacttacaagtggtggagatgcaccagggatgaacgcagctata
agagctgtggtgaggacaggaatttattatgggcttaaagtaaaaggcattatgagggga
tatgcagggttagtagaggatgaagttattgatttaaatctttcttcggtaggagatata
ctacaaaaaggtggtactattttaagaactgctagatgtgaagaatttaagaaaaaagag
gtgcgcaaaaaagcttacgaaactcttcaaaaacatggaatagaaggtctggtaataatt
ggaggagacggttcttttagaggtgcacagcttttgagtgaggagtggaatgtaaataca
attgggattccaggtacaattgataatgacataccttgtacggattatacaataggtttt
gatactgcttgcaatactgtcattgacgcgataaataaaataagggatactgctacttcc
catgaaagagcaaatataatagaagtgatgggaagaaatgcgggctacattgctttgtat
gctggtctggctggtggagcagagatgattatacttcctgaagtggaatggagcatcgat
gagctttgtgataaaatcacttatgggataaagagggggaagcttcaccatataattgtt
cttgcagagggagttatgagtgctccagagctagcgaaaatgattaaagaaagactacca
aaattggacttaaggtatactattttggggcacattcaaagaggtggagctcctacagtg
atggatagggtattggcaagccaaatgggggcaagagcagtagaattgcttttagaaaat
aaaactaaaagaataataagtatacgaaacaatcaaattgtagatgatgatatagatgag
gctctttccatgaagaaagagtttaacagaaaactttatgagctcagcaagatattgtct
atataa

DBGET integrated database retrieval system