KEGG   Thermoanaerobacter italicus: Thit_1716Help
Entry
Thit_1716         CDS       T01178                                 

Definition
(GenBank) glycoside hydrolase clan GH-D
  KO
K07407  alpha-galactosidase [EC:3.2.1.22]
Organism
tit  Thermoanaerobacter italicus
Pathway
tit00052  Galactose metabolism
tit00561  Glycerolipid metabolism
tit00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:tit00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Thit_1716
  Lipid metabolism
   00561 Glycerolipid metabolism
    Thit_1716
   00600 Sphingolipid metabolism
    Thit_1716
Enzymes [BR:tit01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Thit_1716
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Melibiase Glyco_hydro_36N Glyco_hydro_36C Melibiase_2 Glyco_hydro_31 GHL10
Motif
Other DBs
NCBI-ProteinID: ADD02962
JGI: Thit_1716
UniProt: D3T410
Position
complement(1733196..1735388)
Genome map
AA seq 730 aa AA seqDB search
MPIYFNEKTRTFHLIARVTTYIIHVLKNGAVLHVYFGKKIKNPNIYNLLKLPQINLVDTD
IVNFGNQLMLDFLPQEYPAYGNTDFRSPAYQIQLENGSTVSDLRYLSHKIYKGKPKLEGL
PATYVENEDEADTLEIELYDKVANLKVTLIYTAFRDYDVITRSVRFENMGKEDIKLLRAL
SMNVDFNDDKFDMLQLSGAWARERHVIRRSLTPGVQSIESRRGASSHQQNPFIALLRKDA
DEWHGDVYGFSLVYSGNFLAQVEVDQYKMARVSMGINPFDFSWLLKPGETFQTPEVVMVY
SDSGLNKMSNTYHKLYRNRLMRSKFKDKERPILINNWEATYFDFTEEKLKELAKEAKDLG
IELFVLDDGWFGKRNSDNSSLGDWFVNKEKIPSGLDGLAKEINSLGLKFGLWMEPEMVSP
DSDLYREHPNWCIHVPNRPRSESRNQLVLDLSRKDVQDYIIKVVSDILESANISYVKWDM
NRNMTEIGSALLPPERQRETAHRYILGLYRILEEITTRFPDVLFESCAGGGGRFDPGMLY
YMPQTWTSDNTDAVERLKIQYGTSIVYPLISMGSHVSAVPNHQVHRITPLKTRLDVAISG
NFGFELDLTKLSEEEKDLAKKYVKKYKEIRKLIQFGDFYRLLSPFEGNETAWMFINEEKT
EFVAFYFKVLATPNDTIKRIYLKALNPDYKYALQDTGEVYGGDELMYAGIAIPQLEGDFQ
SVMMHFKKEA
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
atgcctatctatttcaatgaaaaaacaagaacctttcacttaatagcaagggtcacaacc
tatataattcatgttttaaagaatggtgcagttttgcatgtttattttggaaagaaaata
aaaaatcctaatatatataatctactaaagttaccgcagataaatttggtagataccgat
attgttaattttggcaaccaattaatgttagattttttaccacaagaatatcctgcgtat
ggcaatactgattttagaagtcctgcatatcaaattcagcttgaaaatggttctactgtt
tctgatctaaggtacttatctcacaaaatctataaaggtaagcctaaattagaagggctt
ccggctacttatgttgaaaatgaagatgaagctgatactcttgaaatagagttatatgat
aaagtagcaaatttaaaagtaactttaatttacacagcatttagagattatgatgttatc
acaaggtcagtgagatttgaaaacatgggaaaagaagacataaaattgttaagagctttg
tctatgaatgttgattttaatgatgataagtttgacatgcttcaattgtcaggggcttgg
gcgagagaaagacatgttataagaagatcacttactcctggagttcagtctattgaaagc
agaagaggtgcaagcagccatcagcaaaatccttttatagcacttttaaggaaagacgct
gatgaatggcatggagatgtttatggatttagccttgtttacagtggcaatttcttggca
caagtagaagtggatcaatataagatggcgagagtctctatggggattaatccatttgat
ttttcatggcttttaaaaccaggtgaaacatttcaaacaccagaagtggttatggtttat
tcggatagtggcttaaataaaatgtcaaatacctatcacaaactgtacagaaatagactt
atgagaagtaaatttaaggacaaagaaagaccaattcttataaacaattgggaagctact
tattttgattttaccgaagaaaaacttaaagaacttgctaaagaagctaaagatttgggt
attgaattgtttgttcttgacgatggatggtttggaaagagaaattctgacaattcttca
ctgggagattggtttgtaaataaagaaaagattccaagtggtttggatggtcttgcaaaa
gagataaattctttaggtttaaaatttggattatggatggaaccagaaatggtgtctcct
gatagtgacctctatagagagcatcccaattggtgtatacatgtacctaataggccgaga
agtgaaagcagaaatcaacttgtgttagacttgtcgcgcaaagatgtacaagattatatt
ataaaagtagtgtcagatattttggaaagcgccaacataagttatgtaaaatgggatatg
aatagaaatatgacagagataggctctgcacttttgcctcctgaaagacaaagagaaact
gctcacagatatattcttggactttacagaatattagaagaaataacgacaaggtttcct
gatgttttgtttgaaagttgtgctggtggtggcggtcgttttgaccctggaatgctttat
tatatgccccagacttggactagtgataatacagatgcagttgaaagacttaaaatacag
tatggtacaagtatagtttatcctcttatttcaatgggaagccatgtgtctgctgtgccc
aatcaccaagttcatagaataactcctttaaagactcgtcttgatgtggcgatatcaggt
aattttggatttgagcttgatttaacaaagcttagtgaagaggaaaaagaccttgctaaa
aaatatgttaaaaagtacaaagagataagaaaattgattcaatttggagatttttacaga
ttattaagtccttttgaaggaaatgaaacagcatggatgtttattaatgaagaaaaaact
gaatttgtggctttttactttaaagtcttggcaactcctaatgacacgataaaaaggatt
tatttaaaggctttaaaccccgattacaaatatgcattgcaagatacgggtgaagtgtat
ggtggtgatgagcttatgtatgcaggcattgcaataccacaattggaaggagattttcaa
agtgttatgatgcattttaaaaaggaggcgtaa

DBGET integrated database retrieval system