KEGG   Thermoanaerobacter italicus: Thit_1762Help
Entry
Thit_1762         CDS       T01178                                 

Definition
(GenBank) glucokinase, ROK family
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
tit  Thermoanaerobacter italicus
Pathway
tit00010  Glycolysis / Gluconeogenesis
tit00052  Galactose metabolism
tit00500  Starch and sucrose metabolism
tit00520  Amino sugar and nucleotide sugar metabolism
tit00521  Streptomycin biosynthesis
tit01100  Metabolic pathways
tit01110  Biosynthesis of secondary metabolites
tit01120  Microbial metabolism in diverse environments
tit01130  Biosynthesis of antibiotics
tit01200  Carbon metabolism
Module
tit_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tit00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Thit_1762
   00052 Galactose metabolism
    Thit_1762
   00500 Starch and sucrose metabolism
    Thit_1762
   00520 Amino sugar and nucleotide sugar metabolism
    Thit_1762
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Thit_1762
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Thit_1762
Enzymes [BR:tit01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Thit_1762
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG FGGY_N Hydant_A_N Pan_kinase Glucokinase
Motif
Other DBs
NCBI-ProteinID: ADD03006
JGI: Thit_1762
UniProt: D3T454
Position
complement(1789526..1790464)
Genome map
AA seq 312 aa AA seqDB search
MRIGVDLGGTNIAVGLVDDEGRIVATGSRPTKPERGYEAVAKDIAEIALELINRTNTDIK
EIKSMGIGVPGVADSEKGIVIRAVNLFWTKVPLAKEIKKYIDLPIYMDNDANVAALAEAV
FGAGRGSKSSVTITLGTGVGSGFVLDGKIYNGAHHFAPEIGHIVIGDNGIRCNCGKIGCL
ETYASATALIREGKRAAKKDPNSLILKFANGDIESITAKNVIDAAKQYDEEAIKIFNDYV
KYLAIGIVNVINMFDPEVIILGGGVANAGDFLIKPLKKEVAENILFKDLPYADIRKAELG
NDAGIIGAAILG
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgagaattggcgttgaccttgggggaactaatattgctgttggattggtagatgatgaa
ggacgtatagtagcaacaggcagtagacccacaaaaccagaaagaggttatgaagcggtt
gccaaggatatagcagaaatagctcttgagcttattaatagaactaatactgatataaaa
gagattaaatcaatgggtattggagttccaggagtagcagacagtgaaaagggtatagtg
atacgggcagttaatcttttttggacaaaagtacctcttgcaaaagaaataaaaaaatat
attgatttgccaatttatatggacaatgacgcaaatgtagcggctttggcagaggcggta
tttggtgctggcagaggttcaaaatcatctgtgacaattactttaggcacaggagtaggg
tctggatttgttctagatggcaaaatatataacggtgctcaccattttgcacctgagatt
gggcacatagtgataggagacaatggcataaggtgcaattgtggtaagatcggatgtttg
gagacatacgcttcagctactgctttaataagagaagggaaaagggccgctaaaaaagac
cctaactctcttattttaaaatttgcaaatggggatatagaaagtataacggctaaaaat
gtaattgatgccgcaaagcagtatgatgaagaggctatcaagatttttaatgactatgtc
aaatatttagctattggaattgtaaatgtcataaacatgtttgaccctgaagtgataata
ttgggtggcggtgttgcaaacgcaggagattttctcataaaacccctcaaaaaagaagtg
gcggagaatattttgtttaaagaccttccttatgctgacataagaaaagcagagcttgga
aatgatgcggggatcatcggtgctgctatactaggttaa

DBGET integrated database retrieval system