KEGG   Thermoanaerobacter italicus: Thit_1819Help
Entry
Thit_1819         CDS       T01178                                 

Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
tit  Thermoanaerobacter italicus
Pathway
tit00340  Histidine metabolism
tit01100  Metabolic pathways
tit01110  Biosynthesis of secondary metabolites
tit01230  Biosynthesis of amino acids
Module
tit_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:tit00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Thit_1819
Enzymes [BR:tit01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Thit_1819
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh MafB XH
Motif
Other DBs
NCBI-ProteinID: ADD03062
JGI: Thit_1819
UniProt: D3T4B0
Position
complement(1853080..1854363)
Genome map
AA seq 427 aa AA seqDB search
MIEIFDFRKGIDNGILQKLHNRSKLENKEIAKKVEEIISNVGERKDQALFEYTYMFDGIN
LDKSTVKVTKEEIKNAYKEVGEEFLKAIDKAIKNITEFHEKQKQSTWMDFKEGIVYGQII
RPLSQVGIYVPGGTASYPSSVLMNGIPAKVAGVEKIVMVSPAGKKGINPYVLVAADRIGI
EDIYKVGGAQAIAALAFGTESIPKVDKIVGPGNIFVAMAKRALYGYVDIDMVAGPSEVLV
IADETANPKYVAADLLSQAEHDVMASSILVTTSLEVAQQVKIEIERQMEYLERKEIIEKS
LKNFGAIIVVNNLKEAIGIANDIAPEHLELNISNAFEIIGEIKNAGAVFVGEYSPEPLGD
YLAGPNHVLPTSGTARFFSPLSVTDFIKKMNILYYSKDSLEEVKKDVITFANSEGLTAHA
NSIKVRF
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgattgagatatttgattttcgaaagggaattgacaatggcattttgcaaaagcttcac
aacagaagtaaattagagaataaagaaatagcaaaaaaagtggaagaaataatttcaaac
gtaggagagagaaaagaccaggctttgtttgagtatacttacatgtttgacggaataaat
cttgacaaaagtactgtaaaagttacgaaagaggaaataaaaaatgcttataaagaagta
ggagaggaatttttaaaagcgattgacaaagctatcaaaaacataacagaatttcatgaa
aagcaaaaacagtctacatggatggattttaaagaaggtatagtttatgggcagataata
agacctctttctcaagttggaatttatgtgccggggggaaccgcttcttatccttcttca
gttttgatgaatggaatacctgcaaaggtggctggtgtagagaaaatagtgatggtttct
ccggctggtaagaagggaataaacccttatgtgttagtggctgcagataggataggaata
gaggatatatataaagttggcggtgcacaggctattgcagccttggcctttggtacagag
tcaatacctaaggtggataaaatagttggcccgggaaatatttttgtcgcaatggctaaa
agagctctttatggatatgtagatattgatatggtggcagggcccagtgaagttttggta
atagctgacgaaactgctaatcctaaatatgtggcggcggacctgctgtcacaggcggaa
cacgatgtaatggcatcttcaatacttgtaaccacatctttggaggttgcgcaacaagta
aaaatagaaattgaaaggcaaatggaatatcttgaaaggaaagaaataattgaaaagtct
ttaaaaaattttggcgcgataattgttgtaaataatttaaaagaagcaattggtattgca
aacgacatagctccggagcatttagagcttaacatttccaatgcctttgaaataattggt
gaaatcaagaatgcaggagcagtctttgtgggagaatattctccagaacccttaggggac
taccttgctggccctaaccatgtgcttcctaccagtggaacagcaaggtttttctcacct
ctttctgtgacggactttatcaaaaagatgaatattctctattattctaaggattcttta
gaagaggtaaaaaaggatgtaatcacttttgcaaattcagaagggcttaccgctcatgct
aattctataaaagtgaggttttaa

DBGET integrated database retrieval system