KEGG   Thermoanaerobacter italicus: Thit_1862Help
Entry
Thit_1862         CDS       T01178                                 

Definition
(GenBank) helix-turn-helix domain protein
Organism
tit  Thermoanaerobacter italicus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1907945..1908343
Genome map
AA seq 132 aa AA seqDB search
MDTVGERIKYARKKNNLTITALSKLTGLSVGNLSDLENNKSMPSSNALIKLKNALNVSID
WLLTGQQIEYVKEEEAKYLSREEFENISEKDKIIFKAFEMLPEERKKDIEGYIKVSLNTT
DLEKYIKKEKEV
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atggatacagttggagaacgcataaaatacgcccgcaaaaaaaataatttgactataacg
gctttaagcaaacttacgggtttatctgttggaaatttaagtgaccttgaaaataacaaa
tcaatgccttcttccaatgctttgataaagttaaaaaacgctcttaatgtttcaatagat
tggcttcttactggacaacaaatagaatatgtaaaagaagaagaggcaaaatatttatcg
agggaagagtttgaaaacatcagtgaaaaggataaaataatttttaaagcttttgaaatg
ttgcctgaggaaagaaagaaagatatagaagggtatataaaagtgagtttgaataccact
gatttagaaaagtatataaaaaaagaaaaggaagtgtaa

DBGET integrated database retrieval system