KEGG   Thermoanaerobacter italicus: Thit_1958Help
Entry
Thit_1958         CDS       T01178                                 

Definition
(GenBank) ribosomal protein S8
  KO
K02994  
small subunit ribosomal protein S8
Organism
tit  Thermoanaerobacter italicus
Pathway
Ribosome
Module
Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:tit00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    Thit_1958
Ribosome [BR:tit03011]
 Ribosomal Proteins
  Bacteria
   Small subunit
    Thit_1958
  Archaea
    Thit_1958
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(2004739..2005137)
Genome map
AA seq 132 aa AA seqDB search
MVMTDPIADMLTRIRNANIARHETVEIPASKMKKAIAEIMLKEGFIKSVEEIDDGKGGIL
KLTLKYGPNKERVISGLKRISKPGLRVYAKHDELPRVLGGLGIAIISTSKGIMTDKEARK
AGVGGEVICYIW
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atggtaatgacagatcctatagcagatatgctgacccgaataagaaatgcgaatattgca
agacatgaaacagtagaaatacctgcttcaaagatgaaaaaggctattgcagagattatg
ttgaaagaagggtttataaaatcagtagaagaaatagacgatggaaaaggtggtattctc
aaattaactttgaaatatggtcctaataaggaaagagttatatctgggttgaaaagaata
agtaaacctggtttgagagtatatgctaaacacgacgaattaccgcgggtattaggaggt
ttaggaatagcgattatatcaacttcaaaaggcataatgacagataaagaagcaaggaaa
gcaggagttggaggagaagtcatttgctacatttggtga

DBGET integrated database retrieval system