KEGG   Thermoanaerobacter italicus: Thit_2153Help
Entry
Thit_2153         CDS       T01178                                 

Definition
(RefSeq) phosphoglycerate mutase 1 family (EC:5.4.2.4)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
tit  Thermoanaerobacter italicus
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:tit00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Thit_2153
   01230 Biosynthesis of amino acids
    Thit_2153
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Thit_2153
  Energy metabolism
   00680 Methane metabolism
    Thit_2153
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Thit_2153
Enzymes [BR:tit01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Thit_2153
Exosome [BR:tit04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Thit_2153
  Exosomal proteins of melanoma cells
   Thit_2153
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2191268..2192023)
Genome map
AA seq 251 aa AA seqDB search
MYKVVLLRHGESLWNMENRFTGWTDVDLSPKGIEEARESGKTLKAEGYIFDCAFTSVLKR
AIRTLWIVLDELDLMWIPVYKSWRLNERHYGALQGLNKAETAKKYGEEQVKIWRRSADVR
PPALEKDDPRYPGFDPRYADLSEEEIPLTENLIDTINRVTSYWESTIAPTIKSGKKVLIV
AHGNSLRGLVKYLDNLSNEEIMELNIPTGIPLVYELDGDLKPIKHYYLADEEKVKEKKEL
VAKQGKVQGNS
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgtataaagttgttttgctaagacacggagaaagcctgtggaatatggaaaacaggttt
actggctggacggatgttgatttatctccaaagggaattgaagaagctcgggaaagcggc
aagactttaaaggcagaaggatatatttttgactgcgcttttacttcggttttaaaaaga
gctataagaactttatggattgttcttgacgaattagatttgatgtggataccggtttat
aaatcatggaggctcaatgaaaggcattatggagcactgcaagggctcaataaagctgaa
actgccaaaaaatacggagaagagcaggtaaaaatatggagaaggtctgctgatgtaagg
cctcccgccttagaaaaagatgacccgaggtatcccggttttgaccctagatatgctgac
ctttctgaagaagaaattccccttactgaaaatttgattgatacaattaacagagttact
tcctattgggagtccacaattgcaccgactataaaatcaggtaaaaaagtactaatagtt
gctcatggaaatagtttgagagggcttgtaaaataccttgacaatctttcaaatgaagag
ataatggagctaaacattcctacagggattccactagtttatgagcttgatggtgattta
aagcctataaagcattattatcttgccgatgaagagaaggtaaaagagaagaaagaattg
gtagctaaacaaggaaaggttcaagggaattcttaa

DBGET integrated database retrieval system