KEGG   Thermoanaerobacter italicus: Thit_2204Help
Entry
Thit_2204         CDS       T01178                                 

Definition
iron-containing alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
tit  Thermoanaerobacter italicus
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:tit00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Thit_2204
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Thit_2204
   00620 Pyruvate metabolism
    Thit_2204
   00650 Butanoate metabolism
    Thit_2204
  Lipid metabolism
   00071 Fatty acid degradation
    Thit_2204
  Amino acid metabolism
   00350 Tyrosine metabolism
    Thit_2204
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Thit_2204
   00626 Naphthalene degradation
    Thit_2204
Enzymes [BR:tit01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Thit_2204
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Thit_2204
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2245529..2248147
Genome map
AA seq 872 aa AA seqDB search
MPTLLQEKKEAKEKTEVKETTDVKKQIDLLVERAKRAQEKLMSYTQEQIDEIVKVMALAG
IEKHVELARLAHEETKMGVYEDKITKNLFAVEYVYNYIKDKKTVGILSENLEENYMEVAE
PVGIISGVTPVTNPTSTTMFKCLIAIKTRNPIIFSFHPKALKCSIEAAKTMYKAALKAGA
PEGCIGWIETPSIEATQLLMTHPGVSLILATGGAGMVKAAYSSGKPALGVGPGNVPCYIE
KTANIKRAVSDLILSKTFDNGTVCASEQAVIIDEEIANEVKKLMKEYGCYFLNKEETKKL
EEFAIDKNTGLMNPAVVGQPAVKIAQMAGFKVPENTKILVAEYPAVGPEYPLSREKLSPI
LALYTVKDYKEGIKRCEEMIQFGGLGHSAVIHSEKQQIINEFANRVQASRILVNAPASQG
AIGDIYNTATPSLTLGCGTMGGNSTTDNVSVYNLINIKRVFIRKERMKWFRVPPQIYFER
GSIQYLSQVKGKKAFIVTDPTMVKLGFVDKVTYQLDKANIKYEIFSEVEPDPSVDTVEKG
IKIMKEFEPDLLIAVGGGSAIDAAKGMWLFYEYPDTKFEDLRLKFMDIRKRTYRFPELGK
KALFIAIPTTSGTGSEVTAFAVITDKKRNIKYPLADYELTPDIAIIDSDFVMTIPPSVTA
DTGMDALTHAIEAYVSVMASDYTDALAEKAIKLIFEYLPKAYKNGQDKVAREKLHNASCL
AGMAFTNAFLGLNHGMAHILGAKFHLPHGRANAILLPYVIEYNAELPKKFASFPQYEYPK
AAEKYAEIAKFLGLPASTTDEGVKSLIEAIKNLMKELNLPLTLKEAGINKEEFEKQIMEM
ADIAFNDQCTGSNPRMPLVSEIAEIYRKSYGE
NT seq 2619 nt NT seq  +upstreamnt  +downstreamnt
atgcctactttattacaagaaaaaaaggaagcaaaagaaaaaacagaagtaaaagaaaca
acagatgttaaaaaacaaatagacctattagtagaaagggcaaaaagagcccaagaaaaa
ttaatgtcatacactcaagagcaaattgatgaaatagtcaaagttatggcactagcgggc
atagaaaagcatgtagaactggcaagattagctcatgaagaaacaaaaatgggtgtttat
gaagacaaaataacgaaaaatctctttgcagtagaatatgtgtacaattatataaaagac
aaaaagaccgtcggcatccttagtgaaaacttagaagaaaattatatggaagtggcagaa
cctgtaggaattatatcaggggttacccccgtgacaaaccctacctctacaacaatgttt
aaatgcttaatagccatcaaaacaagaaatccaataatttttagtttccatcctaaagcg
ttaaaatgtagtatagaagcagcaaagaccatgtacaaggcagcattaaaggcgggtgca
cccgaaggatgcataggttggattgaaacaccttcaattgaagcaacgcaacttctcatg
acacatcccggtgtctctcttatcctcgcaacaggcggtgcaggaatggtaaaagcggct
tacagttcaggaaaacctgcccttggagtaggtcctggcaatgttccctgctacattgaa
aaaactgcaaatattaaaagagcagtctcagacctaatacttagcaaaacttttgacaat
ggcacagtatgcgcatcagaacaagctgtgataatagatgaagaaatagccaatgaagta
aaaaaattaatgaaagaatatggttgttatttcttaaataaagaagaaacaaaaaagtta
gaagaattcgctatagacaaaaacaccggtttaatgaatccagcagttgtgggtcagcct
gcagtgaaaattgctcaaatggctggatttaaagttcctgaaaataccaaaatacttgta
gctgaatatccagctgtaggtcctgaatatcctctatccagagaaaaactaagcccaata
cttgctttatatacagtcaaagattacaaagaaggcataaaaagatgcgaagaaatgata
caattcggcggacttggtcactctgcagtaatacattctgaaaaacaacaaattattaat
gaatttgcaaatagagtacaagcaagcagaatccttgtaaacgcccctgcttcacaaggt
gctattggagacatttataacacggctactccatctttaactttgggttgtggtacaatg
ggtggaaattcaacaacagataatgtaagtgtttataaccttataaacataaaacgagtc
tttataagaaaagagagaatgaaatggttcagagtcccaccacaaatttattttgaaaga
gggtcaatacagtatctatcacaagtaaaaggcaaaaaagcctttattgtaacagaccct
acaatggttaaattaggttttgtagataaagtgacatatcaattagataaagcaaatatt
aaatatgaaattttctctgaagtagaaccagacccatcagttgacactgtagaaaaaggg
ataaaaataatgaaggagttcgagcctgacttactaatagctgtaggtggtggttctgca
atagacgcagcaaagggaatgtggcttttctacgaataccctgatacaaaatttgaagac
ctaaggttaaagtttatggacataagaaaaagaacttatagatttcctgaactggggaaa
aaagctttatttatcgcaataccaaccaccagcggcacaggttctgaagttacggccttt
gcagttataacagacaaaaagagaaatataaagtatccccttgcagattacgaattaacg
ccagatattgctataatagactctgactttgttatgacaattccaccctctgtaactgca
gatacaggtatggatgctttaacacatgccattgaagcttatgtatccgtgatggcatca
gactatacagacgccctcgcagaaaaagccataaaactgatatttgaatatctacctaaa
gcatacaaaaacgggcaagacaaagtcgctcgcgaaaagctgcacaatgcttcttgccta
gcagggatggccttcacaaatgcatttctaggattaaaccatggtatggcccacatactc
ggtgctaaattccatcttccgcacggaagagcaaatgcgatacttctgccctatgtcata
gaatacaatgctgagttacctaaaaaatttgcttcattcccacaatatgaatatcccaaa
gcagccgagaaatacgcagaaattgcaaaattcttaggacttcctgcatcaaccactgat
gaaggagtaaaaagtctcattgaagcaataaaaaatctcatgaaagagttaaatcttcct
cttacacttaaagaggcgggaataaacaaagaagaatttgaaaaacaaataatggaaatg
gctgatatagccttcaacgaccagtgtaccggttcaaatccaagaatgccattagtatca
gaaattgcagaaatatatagaaaatcctatggagaataa

DBGET integrated database retrieval system