KEGG   Thermincola potens: TherJR_0070Help
Entry
TherJR_0070       CDS       T01226                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
tjr  Thermincola potens
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:tjr00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    TherJR_0070
DNA repair and recombination proteins [BR:tjr03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      TherJR_0070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
74045..74641
Genome map
AA seq 198 aa AA seqDB search
MYYAEPVARLIEEFAKLPGIGPKTAQRLAFHILNSDAESAHGLAKALINAKQKIRYCSIC
SNLTDTDPCKLCQDSTRDRNTICVVEQARDVVAIERTREYKGLYHVLHGAISPMDGIGPE
QLKIKELLERLQKNSVQEIILATNPNIEGEATAMYLARLLKPMGVRVTRIAHGLPVGGDL
EYADEVTLSKAFEGRREM
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
ttgtactatgccgaaccggtggctcgtttaattgaagaatttgcgaagttgccgggcatt
ggccccaagacggctcaacggctggctttccatatactaaacagtgatgcggaaagtgcg
catggtttggcaaaagccttgataaacgcaaagcaaaaaatcaggtattgttccatttgt
tccaaccttaccgatactgatccttgtaagttgtgtcaggatagcacaagggacagaaat
accatttgtgttgttgaacaagccagagatgtggtggcgatagaacggacaagggagtat
aaaggcttataccacgtcctgcatggggcgatttctcctatggacggtattggtccggaa
cagcttaaaataaaagagctgctggagcggctccaaaaaaattctgtacaggaaatcatc
ttagccacgaacccaaatattgaaggtgaagccacagctatgtacctggccagactctta
aagcctatgggtgtcagggttacccgtatagcccacggcttacccgttggcggcgatttg
gaatatgccgatgaagttaccctgtcaaaggcttttgaggggcgccgggaaatgtaa

DBGET integrated database retrieval system