KEGG   Thermincola potens: TherJR_0113Help
Entry
TherJR_0113       CDS       T01226                                 

Definition
response regulator receiver modulated CheB methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
tjr  Thermincola potens
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:tjr00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    TherJR_0113
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    TherJR_0113
Enzymes [BR:tjr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     TherJR_0113
Two-component system [BR:tjr02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   TherJR_0113
Bacterial motility proteins [BR:tjr02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    TherJR_0113
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
118482..119534
Genome map
AA seq 350 aa AA seqDB search
MTKRIEVLVVDDSAYMRKVVSNMLQSDEEIFVVDTARDGLDALEKIKKWKPDVVTLDVEM
PRMDGLTALQKIMVECPTPVVMLSSLTQEGSETTIKALTLGAVDFVPKPSGAISLDIARV
KEELIRKIKVCAKASLKNIRALQMIAPIPKKEAAAVAAKPLAGKTPSKVVVIGSSTGGPN
ALQQVVPKLPADLPAAVLIVQHMPPGFTKSLADRLNDISGITVKEASAGDTLQTGVALLA
PGGYHMNLVSSTVIGLNQNPPVHSVRPAVDVTMESVVNYYGPNVVGVVLTGMGYDGSGGA
SAIKRAGGKVIAQNEDTCVVYGMPRVVVEMGKADKVLPITEIADEIVKML
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaccaagcgaattgaagttttggtggttgatgactcagcttatatgcgcaaggttgtt
tcgaatatgcttcaatcggatgaagagatttttgttgtcgatacagcgcgggacggtttg
gacgctctggaaaaaataaaaaaatggaaacccgatgttgttactctggacgtagaaatg
ccaaggatggacgggttaacggccctgcagaaaatcatggtggaatgccctactcctgta
gttatgttaagcagtttgacccaggagggcagtgaaactactattaaggcgcttacctta
ggggccgttgattttgtacccaaaccgtcgggggccatatcgctggacattgcaagagtt
aaagaagaacttatccgaaaaataaaggtctgtgccaaggcttcattaaaaaacatccgg
gctttgcaaatgatagctcctataccgaaaaaagaagcagcggctgttgccgccaaacct
ttagccgggaaaacgccgtctaaagtagttgtcattggcagttcgacgggtgggccgaat
gccttgcagcaggttgtgccaaagcttcctgcagatttgcctgctgctgttttaattgtg
cagcacatgccgcccggttttaccaaatcgcttgctgaccggctaaatgatatttccggt
ataaccgtaaaagaggccagcgccggggataccttacagacgggtgtcgccctattggcc
ccaggtggataccatatgaatttggtttccagtaccgttatcggacttaatcagaatcct
ccggtgcattccgttcgtccggcggtggatgtcactatggaatcggtggtaaattactac
ggacccaatgttgttggggttgtgctaaccggtatggggtatgatggctccggtggggct
agcgctattaagcgggcagggggcaaagtaattgcacaaaatgaagatacctgcgtggtt
tatggcatgcccagggttgtggtagaaatgggtaaagctgataaggtactgcccatcact
gagattgccgacgagattgtcaaaatgctgtaa

DBGET integrated database retrieval system