KEGG   Thermincola potens: TherJR_0113Help
Entry
TherJR_0113       CDS       T01226                                 

Definition
(GenBank) response regulator receiver modulated CheB methylesterase
  KO
K03412  two-component system, chemotaxis family, protein-glutamate methylesterase/glutaminase [EC:3.1.1.61 3.5.1.44]
Organism
tjr  Thermincola potens
Pathway
tjr02020  Two-component system
tjr02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:tjr00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    TherJR_0113
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    TherJR_0113
Enzymes [BR:tjr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     TherJR_0113
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.44  protein-glutamine glutaminase
     TherJR_0113
Two-component system [BR:tjr02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   TherJR_0113
Bacterial motility proteins [BR:tjr02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    TherJR_0113
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheB_methylest Response_reg Peripla_BP_2 DUF3530
Motif
Other DBs
NCBI-ProteinID: ADG81006
JGI: TherJR_0113
UniProt: D5X906
Position
118482..119534
Genome map
AA seq 350 aa AA seqDB search
MTKRIEVLVVDDSAYMRKVVSNMLQSDEEIFVVDTARDGLDALEKIKKWKPDVVTLDVEM
PRMDGLTALQKIMVECPTPVVMLSSLTQEGSETTIKALTLGAVDFVPKPSGAISLDIARV
KEELIRKIKVCAKASLKNIRALQMIAPIPKKEAAAVAAKPLAGKTPSKVVVIGSSTGGPN
ALQQVVPKLPADLPAAVLIVQHMPPGFTKSLADRLNDISGITVKEASAGDTLQTGVALLA
PGGYHMNLVSSTVIGLNQNPPVHSVRPAVDVTMESVVNYYGPNVVGVVLTGMGYDGSGGA
SAIKRAGGKVIAQNEDTCVVYGMPRVVVEMGKADKVLPITEIADEIVKML
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaccaagcgaattgaagttttggtggttgatgactcagcttatatgcgcaaggttgtt
tcgaatatgcttcaatcggatgaagagatttttgttgtcgatacagcgcgggacggtttg
gacgctctggaaaaaataaaaaaatggaaacccgatgttgttactctggacgtagaaatg
ccaaggatggacgggttaacggccctgcagaaaatcatggtggaatgccctactcctgta
gttatgttaagcagtttgacccaggagggcagtgaaactactattaaggcgcttacctta
ggggccgttgattttgtacccaaaccgtcgggggccatatcgctggacattgcaagagtt
aaagaagaacttatccgaaaaataaaggtctgtgccaaggcttcattaaaaaacatccgg
gctttgcaaatgatagctcctataccgaaaaaagaagcagcggctgttgccgccaaacct
ttagccgggaaaacgccgtctaaagtagttgtcattggcagttcgacgggtgggccgaat
gccttgcagcaggttgtgccaaagcttcctgcagatttgcctgctgctgttttaattgtg
cagcacatgccgcccggttttaccaaatcgcttgctgaccggctaaatgatatttccggt
ataaccgtaaaagaggccagcgccggggataccttacagacgggtgtcgccctattggcc
ccaggtggataccatatgaatttggtttccagtaccgttatcggacttaatcagaatcct
ccggtgcattccgttcgtccggcggtggatgtcactatggaatcggtggtaaattactac
ggacccaatgttgttggggttgtgctaaccggtatggggtatgatggctccggtggggct
agcgctattaagcgggcagggggcaaagtaattgcacaaaatgaagatacctgcgtggtt
tatggcatgcccagggttgtggtagaaatgggtaaagctgataaggtactgcccatcact
gagattgccgacgagattgtcaaaatgctgtaa

DBGET integrated database retrieval system