KEGG   Thermincola potens: TherJR_0127Help
Entry
TherJR_0127       CDS       T01226                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
tjr  Thermincola potens
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tjr00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    TherJR_0127
Enzymes [BR:tjr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     TherJR_0127
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
136229..137149
Genome map
AA seq 306 aa AA seqDB search
MQQITVPAYGKINLTLDITGKREDGYHELVTLMQQVELHDDVRIRLSPKKRISVLSDHES
VPRDAANIAYRAAQELLCFAGLDLTGLNYGIDIFIAKRIPVEGGMAGGSANAAAVLKGLN
RLLNLNLSTEELMRIGLRLGADVPYCIFGGTAVARGIGEILTRVPSPPTMWMVLVKPDFG
VSTALVYKNFSFHERLCRPDLDLVLNGIERGEIVDIYRGMGNVLESVTLRLYPVLQDIKR
RLADWGAEAVLMSGSGPTVCAFTRSPELAKDLCATAQRNFPASYRVVTTNTISVGEEGNI
SARAEY
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgcaacaaattaccgtacctgcctatggaaaaattaacctgaccctggacataacaggt
aaacgggaagatggataccacgagctggtaacactaatgcagcaggtggagctacatgat
gatgtaaggatccggctgtccccgaaaaaaaggattagcgtattatctgatcacgaatct
gtaccccgggatgctgctaacatagcttacagggcagctcaggaattgttatgctttgca
ggtcttgatttgaccggtttaaattatggcatagacatttttattgccaaacgtattccg
gtggaaggcgggatggctggaggttctgctaacgctgccgctgttctaaagggactgaat
agactgttaaacctgaacctttccacggaagagcttatgcgtatcgggctgcgtctcggg
gctgatgtaccctactgcattttcgggggaacagcggtggcccgcgggataggggaaata
ttaacccgtgtgccgtcgccgcctaccatgtggatggtcctggttaaaccggattttggc
gtttcaacagctctggtttacaaaaacttcagttttcatgaaaggctttgccgtccggac
ctggacctggttttaaacggtattgaacggggcgaaattgtggatatttaccggggaatg
ggtaatgttctggaatcggttactttgcgtttatatccggtgctgcaggatattaagaga
aggctggcggattggggtgcggaggcggttttaatgtcggggagcggtcctactgtttgt
gcttttacccgctcgccggaactggccaaagatttatgtgcaacagcgcagcgaaatttt
cctgcttcttaccgggtagtgacaactaatactataagcgtaggagaagaaggaaatatt
tcagcccgggcagaatattaa

DBGET integrated database retrieval system