KEGG   Thermincola potens JR: TherJR_0212Help
Entry
TherJR_0212       CDS       T01226                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
tjr  Thermincola potens JR
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:tjr00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
223542..224033
Genome map
AA seq 163 aa AA seqDB search
MVRAYIALGSNQDNPREKIRTALQRMHEVDGITVRKVAPLYLTEPVGYEEQEWFYNTVAE
IETALPPSELLAALQKIENHLGRVRTVRWGPRTIDLDIILYGDEKILEEDLQIPHPRFEE
RAFVLAPLKDLAPDMILPSGNKIGEALKRLTDKKFVCIDQKIW
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atggttcgtgcatatattgcacttggttctaaccaggacaacccaagggaaaagataagg
acagcgctgcaaaggatgcatgaagtggatggaattaccgtacggaaagtggctcccctt
tacctcacagaaccagtagggtatgaagaacaggaatggttttataatacggtagcggaa
atagaaactgctttacctccgtcggaactgcttgctgccctgcagaagattgaaaaccat
ttggggcgggttagaaccgttaggtgggggccgagaaccattgacctggatataattctt
tatggagatgaaaaaattctggaagaggaccttcagattccccatccacgctttgaggag
agggcttttgtgcttgcgccgctcaaggacctggcgcctgatatgattcttccttccgga
aataagattggcgaagccctgaaacggctgacagacaaaaaattcgtttgcatagaccag
aaaatatggtaa

DBGET integrated database retrieval system