KEGG   Thermincola potens JR: TherJR_0223Help
Entry
TherJR_0223       CDS       T01226                                 

Definition
magnesium chelatase (EC:6.6.1.1)
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
tjr  Thermincola potens JR
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:tjr00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(234560..235702)
Genome map
AA seq 380 aa AA seqDB search
MRSYTQLTRHDGNAILFEVVEMGIISTLWEVPLHIHAEGLRGTGKTTIMRAARQIMPPIV
RIKNCLYNCDPEKPHCPNHKHLSREEIEQLGTEIVPRPFLEISHSAKIGTIAGSIDLAKI
TNAANPEAALLPGIIPQAHRGIIFIDEINRLADTSPEITDVLLDLMGTKPGRVQIEETGL
PLVEIPVQASVWAASNPDEEPGPLQEIRRQLSDRFDLVVEMGRSHNQESIAEILQQSEQR
RLSKNRVSQETIEHNEKLQKEMERIAKKYETLEMPDYLRNYIARLYVKYNLESFRAIEAI
QHAAVLHCALRQRDKVLVSDIVKVIPLALRHRVDMDTLTKIMNSSADKGPNDGAPPMSFA
NSVKKKNQRFFLQSLIEKTS
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgcgctcttatactcaactaacaaggcacgacgggaatgcaattctttttgaagtcgtg
gaaatgggcattatatcgacactttgggaagttcctttacacatacatgccgaaggccta
aggggaaccggcaagactactatcatgagagcggcccgccaaattatgccccccattgtg
cgcataaaaaactgcctctacaattgtgacccggaaaaaccgcattgtccgaatcataaa
catttatccagagaggaaatcgaacagttgggaacagaaattgtgcccagaccgtttttg
gaaatttcccattcggcaaaaatcggtactattgccggaagtattgacctggcgaaaata
acaaatgctgccaacccggaagcagctttgctgccgggcattattccccaggcacaccgg
ggcataatatttatagacgagattaaccggttagctgatacgtcaccggaaattactgac
gtactgttggacttgatgggaacaaaacccggccgggttcagattgaagaaacaggttta
cccctggtggaaatcccggttcaggcgtcggtatgggccgcttctaaccccgatgaagaa
cccggaccgctgcaggaaattcgccggcagctttccgaccggttcgatttagtagttgaa
atggggcgttcccataaccaggaatcaatagcagaaatcctgcagcagagcgaacaacgg
cgtttatcaaaaaacagggtatcccaagaaaccattgagcacaatgaaaaattgcaaaaa
gaaatggaacggatagctaaaaaatatgaaaccctggaaatgcccgattacctgagaaac
tacatcgcccggttatatgtcaaatataacctggaaagtttccgggctattgaagcaatt
caacacgccgctgtcctgcactgcgctttacggcagcgggataaagtcctggtcagtgat
attgtaaaggtgattccccttgctttaagacacagggttgatatggacacactgactaaa
atcatgaattcaagcgctgataaagggccgaacgatggtgcccccccaatgtcttttgcc
aattcagttaaaaaaaagaaccagagattttttcttcagagcctgatagagaaaacgagc
tga

DBGET integrated database retrieval system