KEGG   Thermincola potens JR: TherJR_0268Help
Entry
TherJR_0268       CDS       T01226                                 

Definition
glutamyl-tRNA synthetase
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
tjr  Thermincola potens JR
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:tjr00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
288776..290230
Genome map
AA seq 484 aa AA seqDB search
MESVRVRFAPSPTGPLHIGGARSALFNWLLARKYNGTMIVRIEDTDLERSSRESEENILK
ALEWLGLDWDEGIGKGGSNGPYRQTERLDIYREYAQKLLAAGQAYYCYCTEEELDAERQA
LLAKGEMPRYLGKCRHLTEEDRARYEAEGRKPVIRFRVPENENIVVRDLVRGNVVFESNG
IGDYVIVKSDGIPTYNFAVVLDDALMGITHVVRGEEHLSNTPRQLMIYDALGLQAPQFAH
VSLILGKDRSKMSKRHGATAIEQYEKLGYLPEALVNFLVLLGWSPEGEEEIFSLEQLVEQ
FSLDRVAKNPAVFDLDKLNWLNGYYIRQSPVERIAAMALPYLKEAGYVSDQVTADSEWLK
MVVASVQEYLSYVAEITEHVKIYFNEDFDFESEEAKNILLDEDFPRVAELFKEKITALEE
LTPETAKQMLKALTKELKLGGKKVYMPLRVALTGQTHGPELFYIIPILGKEKALARLASS
QAKL
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atggaaagtgttcgtgtccgttttgcgccaagtcccacaggacctttacatattggcggc
gcccgttcggcgctttttaactggctactggccagaaaatataacgggacaatgatcgtc
aggatagaagatacagacttagaaaggtccagccgggaatcagaagaaaatattcttaag
gcccttgaatggttgggcctggactgggatgagggcataggaaaaggcggcagcaacggg
ccgtaccggcagacagaaaggcttgacatctacagggaatatgctcaaaagttgcttgct
gcagggcaagcatattattgttactgcacggaagaagaattggatgccgagcgacaggcg
ctgctggccaagggagagatgccccgttacctgggcaaatgccggcatctgacggaagag
gaccgggcccgctatgaggcggaaggtcgtaaacccgttattcgtttccgggttcccgaa
aacgaaaatattgtggtgcgggacttggtaagaggaaacgtagtttttgagagcaatggc
ataggggactacgtaatagtaaagtctgacgggatacctacctataattttgccgtagtc
cttgatgatgctctgatgggtattactcatgtggtgaggggtgaagaacacctctccaat
acgccgcggcagttaatgatttatgatgctttgggtttacaggctccccagtttgctcat
gtttctcttatcttaggcaaggacaggagcaagatgagcaaacggcacggggctacggcc
atcgaacaatatgagaagctgggttatctaccggaggcgctggtcaatttcctggtcctc
ctcggatggtctcccgaaggtgaggaagaaatattttctcttgagcaattagtagaacag
ttttctctggacagggtggctaaaaaccccgccgttttcgacctggataaactgaattgg
ttgaatggttattacatcaggcagagccctgtggaaaggattgctgctatggcgctgcct
tacctgaaggaggcaggttatgtgtcggaccaggtaacggccgattctgaatggctcaag
atggtagttgcttcggtgcaggaatacctgtcttacgtggcggaaattactgaacatgtg
aagatatattttaatgaagactttgattttgaatcggaagaggctaaaaacatattgctt
gacgaggattttcccagagtggcggagctgtttaaagaaaaaattaccgcattggaagaa
ttgactccggagaccgctaaacagatgctgaaggccttgacaaaagaactgaaactgggc
gggaaaaaggtatatatgcctctccgggtagcgcttacggggcagacccatggtccggag
ttattttatatcatacccatattaggtaaggaaaaagccctggcccgcttggcctcaagc
caggccaagttgtaa

DBGET integrated database retrieval system