KEGG   Thermincola potens: TherJR_0368Help
Entry
TherJR_0368       CDS       T01226                                 

Definition
acetate/CoA ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
tjr  Thermincola potens
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tjr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TherJR_0368
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TherJR_0368
   00620 Pyruvate metabolism
    TherJR_0368
   00640 Propanoate metabolism
    TherJR_0368
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    TherJR_0368
   00680 Methane metabolism
    TherJR_0368
Enzymes [BR:tjr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     TherJR_0368
Lipid biosynthesis proteins [BR:tjr01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   TherJR_0368
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
377944..379872
Genome map
AA seq 642 aa AA seqDB search
MDTNANAIENRVFYPSEEVVKNANATPELYEEAKKDRLGFWDRMAKELVTWFEPYDKVLD
DSNPPFYKWFTNGKLNVSYNCVDRHAKSEKRNKAAICYESEIGKKVVLTYGQLYREVNMF
ASALSKLGVKKGDRVCLYMPMIPEAAIAMLACTRIGAPHSIVFGGFSSDSLRDRINDAKA
KLVITADGNFRRGTPFPLKKNADEALKETPTVEKVVVVKNAGNEVEMVEGRDVWYHDIMA
TADTYYEPEKMDAEDMLFILYTSGSTGKPKGVVHTTGGYLVQTQATLKYVFDLKETDVYW
CTADIGWITGHSYVVYAPLALGMTTFMYDGTIDYPDKDRMWDMAERWGVNVFYTAPTAIR
TFMKWGTEYPKKHDLSQIRLLGTVGEPINPEAWMWYYENIGGGRCPIMDTWWQTETGAFM
ITPLPITPLKPGTATVPFPGIEVDVVDENKQPTDRGYLVVKSPWPSMLRTIYGDDQRYID
QYWKRFGDYYFAGDGAKRDEMGYIWVTGRVDDVLNVSGHRLGTAEIESALVECAEVAEAA
VIGKKHDVKGESVCAFVILKDGFEGTPELVEKLRKHVGVKIGPIARPDDIIFTAALPKTR
SGKIMRRLLRDIAEGRALGDITTLADPGAMQEIAAKYAGKED
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atggataccaatgctaatgctattgaaaatcgagtgttttacccgtctgaagaggttgtc
aagaatgctaacgccacaccggaactttatgaggaggctaaaaaagaccggcttggtttt
tgggacagaatggccaaagaactggttacctggtttgaaccttatgataaggtcctggat
gacagtaaccctcccttctataagtggtttacaaacggaaaactgaacgtatcttataac
tgtgttgaccgtcacgccaaatcggaaaagcgcaataaagcagctatctgctatgaaagt
gaaatcgggaaaaaagttgtcctgacatatgggcagctctaccgggaagtaaacatgttt
gccagtgcgctgtccaaactgggtgttaaaaaaggcgaccgggtctgtctgtatatgccg
atgattcctgaagcggctattgccatgctggcctgcaccaggattggcgcgcctcactcc
atcgtatttggtggtttcagttccgactcactccgcgacaggattaatgacgccaaggcc
aaactggttatcaccgccgacggtaacttccgcaggggtacgcccttcccgttaaagaaa
aatgccgatgaagcactgaaagaaaccccaactgtagaaaaagtcgtggtagtgaaaaat
gccggtaatgaggtggaaatggtagagggccgagatgtctggtatcacgacataatggcc
accgcggatacttactatgaacccgaaaaaatggacgccgaagatatgctgtttatcctt
tacacttccggatccaccggaaagcccaagggtgttgtgcatactaccggcggctacctc
gtgcaaactcaggctacattgaagtacgtctttgacctgaaagaaacagatgtctactgg
tgtactgccgatatcggctggattaccgggcacagctatgttgtctatgctcccctggct
ttggggatgaccacttttatgtatgacgggaccattgattacccggacaaggacaggatg
tgggatatggccgaaagatggggcgttaacgtattctataccgctccaactgccatccgc
accttcatgaagtggggcactgagtatcccaaaaaacatgatttatcgcagatccggctc
ctgggtaccgtcggggaacctatcaacccggaagcctggatgtggtattacgaaaatatt
ggcggcggccggtgtccgattatggatacatggtggcagacagagacgggcgcctttatg
ataactccgctgcccattacaccgctgaaaccgggtacagccactgttccgttcccgggc
attgaagtagatgttgtggatgaaaacaaacagccaacagatcggggatatctggtagtc
aagtctccgtggccttcaatgttaagaaccatttatggtgatgatcagcggtacattgat
caatattggaagcgttttggcgattactactttgccggagacggtgccaagagagacgaa
atgggctatatctgggttactggccgtgttgacgatgtgttaaatgtatcgggccaccgc
cttggtaccgccgaaatcgagagcgcccttgtagaatgtgcagaagtggctgaagctgct
gtcattggcaagaagcatgatgttaaaggcgaatcggtatgtgccttcgttattctgaag
gatggtttcgaaggaacaccggagttggttgaaaaacttagaaagcatgtaggagtgaag
attggccccattgccagacccgacgacattatctttaccgctgcgttgcccaagacccgt
tccggtaagattatgcgccgtctgttaagggatattgccgaaggtcgtgctctgggcgac
ataactacattggcagacccgggcgcaatgcaggagattgctgccaaatatgccggcaag
gaagactaa

DBGET integrated database retrieval system