KEGG   Thermincola potens: TherJR_0370Help
Entry
TherJR_0370       CDS       T01226                                 

Definition
acetate/CoA ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
tjr  Thermincola potens
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tjr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TherJR_0370
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TherJR_0370
   00620 Pyruvate metabolism
    TherJR_0370
   00640 Propanoate metabolism
    TherJR_0370
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    TherJR_0370
   00680 Methane metabolism
    TherJR_0370
Enzymes [BR:tjr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     TherJR_0370
Lipid biosynthesis proteins [BR:tjr01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   TherJR_0370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
381288..383213
Genome map
AA seq 641 aa AA seqDB search
MDNTALENRVFNPPAEIAENANAKADIYEWAKKDRLGFWDAHAKELVTWFKPYDKILDDS
NPPFYKWFVNGKLNVSYNCVDRHAKSNRRNKAAILYESEIGKKVCLTYGMLYREVNKFAN
VLAGLGVKKGDRVALYMPMIPEATVAMLACARIGAPHSLVFGGFSPESLRDRINDCGAKV
LITSDGNFRRGKPFPLKENADKAMEDTPTIEKCIVVKNAENEVVMKEGRDLWYHELMATA
ANYYEPEVMDAEDMLFILYTSGTTGKPKGVVHTSGGYLVQTQATLKYVFDIKEDDVYWCT
ADIGWITGHSYVVYGPLALGTTVFMYDGTIDYPDKDRMWDMAERYGVTKFYTAPTAIRTW
MKWGTEYVKKHDLSAIKILGSVGEPINPEAWMWYRENIGHGEAPIMDTWWQTETGAHMVT
PLPGVTPLKPGTATVPFPGIEVDIVDENKNSVNEGYLVVKSPWPSMLRTVYGDDNRYIDQ
YWKKFGDFYFAGDGAKRDEMGYIWVTGRVDDVLNVSGHRLGTAEVESALVECEEVAEAAV
VGKKHEVKGESVCAFVILKDGFEGSPELIEKLKKHVGVKIGPIAKPDDIIFTSSLPKTRS
GKIMRRLLRDIAEGRAIGDVTTLADPGAMQEIAAKYAGKED
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
atggataacaccgctttagaaaaccgtgtttttaacccgccggctgaaattgccgagaat
gctaatgcgaaagccgatatttatgaatgggcgaaaaaagaccggcttggattctgggat
gcccatgccaaggaattggttacctggttcaagccttatgataagattcttgatgacagt
aatccgcctttctacaagtggtttgtcaacggcaaactgaatgtttcttataactgtgtg
gaccgccatgctaaatcgaatcgtcgcaataaggctgctattttatacgaaagtgagatc
ggcaaaaaggtatgccttacttatggtatgttgtatcgtgaagtaaacaaatttgcaaat
gtattggccggccttggtgtaaagaaaggtgacagggttgctttgtacatgcccatgatc
ccggaagctaccgttgctatgttggcttgcgcaaggataggtgcgccgcattcgctggtg
tttggtggtttcagcccggaatccctgcgcgaccggattaatgactgcggggcgaaagta
cttattacttccgacggtaacttccgccgcggtaagcctttcccgctgaaagagaacgct
gataaggccatggaagatacacctactatcgaaaaatgtatcgttgtcaagaacgccgaa
aacgaagtcgttatgaaagaaggccgtgacttgtggtatcatgaactgatggctaccgct
gccaactactatgaaccggaggtaatggatgctgaagatatgcttttcatcctttatact
tccggtacaacgggaaaacccaagggtgttgtgcataccagcggtggctatctggtacaa
acccaggctactcttaaatacgtctttgatatcaaggaagacgatgtatactggtgtacg
gcggatatcggttggattaccggccacagttatgtagtctacggtccgctggcacttggt
acaaccgtatttatgtatgacggtaccattgattatcctgataaggacaggatgtgggat
atggccgaaagatacggcgttaccaagttttatactgcacccaccgccatccgtacctgg
atgaagtggggtaccgaatatgttaagaagcatgacctgtctgccatcaagattctgggt
tccgttggcgagcctattaacccggaggcctggatgtggtaccgtgagaacattggccac
ggcgaagcgccaattatggatacctggtggcagacagaaacgggggcgcacatggttacc
ccgttgccgggagttactccgctgaagccgggcaccgctaccgtaccgttccccggtatc
gaagttgatatagttgacgaaaacaagaattctgtaaatgagggctatctggttgtcaag
tccccctggccgtccatgttgagaactgtttatggtgatgacaacaggtatattgaccag
tactggaagaagtttggtgacttttactttgccggcgacggcgctaagcgggatgagatg
ggctatatttgggtaacgggccgcgtcgacgacgtccttaacgtatcgggacaccggctc
ggaacagcggaagttgagagcgctcttgttgaatgcgaagaagtagcggaagctgctgta
gtgggcaaaaagcacgaggttaaaggcgagtctgtatgtgcctttgttatcctgaaagac
ggtttcgaagggtctccggaacttattgagaaactgaagaagcatgttggtgtgaagatc
ggtcctattgctaagcctgatgacattatctttacttccagcttgccaaagacacgttcc
ggaaaaattatgcgccgcctcctgagggatattgctgaaggacgggctatcggcgatgtt
accacgctggctgacccgggtgcgatgcaggaaattgctgccaaatatgccggaaaagaa
gactaa

DBGET integrated database retrieval system