KEGG   Thermincola potens JR: TherJR_0537Help
Entry
TherJR_0537       CDS       T01226                                 

Definition
helicase, RecD/TraA family (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
tjr  Thermincola potens JR
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:tjr03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
535150..537279
Genome map
AA seq 709 aa AA seqDB search
MSGIVERITYTNEETGFSVIRIRSRGFNGLVTVVGNLAAVSVGAVLRLKGEWKHDSKYGK
QFNAHDYRETVPATVAGIEKYLGSGLIKGIGPVYARRIVNHFREDTLRVIEEQADRLLEV
EGIGQKRVEMIKKAWQEQKEIKNVMLFLQSHGVSASYAVKIYKTYGNESINIVKTNPYRL
ADDIWGIGFKTADKIARQLGFDKNSYERCRSGIIYVLNELANEGHCFAVREQLVSETVKI
LELEEPMVKSTIDRMVEEKWVIPDENNAVYLPPFYFSETGTAKRIKEILAVQAPEPAVDI
ERVIKEVQAECGITYDEVQLEAIKTAVTSKFMVLTGGPGTGKTTATLAIIRVFQKLGASC
ILAAPTGRAAKRLSETTGMEAKTIHRLLEYKPPEGYRRNGENPLECDVLVVDETSMVDII
LMYNLLKAVSNETVVILAGDVDQLPSVGAGNVLKDIIDSGTVPVVRLTRIFRQAMGSAII
TNAHRINRGEMPNLRGGRNSDFFFIEEEDPLKVTETVKDLCTKRLPGYYKIDPINDIQVL
CPMQRGGTGAQNLNTVLQEALNPTNVTIKYGGTVFRLNDKVMQIKNNYEKNVFNGDIGTI
VKIDMEDKTLVIRFDGNDVDYDATELDEVVLAYATTVHKSQGSEYKVVVAPFTMQHYMML
QRNLLYTCVTRAKQVFVLVGSKKAVAIAVSNNKIQRRNTMLAKRLAQLG
NT seq 2130 nt NT seq  +upstreamnt  +downstreamnt
ttgagcggtattgtcgaacggattacatacacaaatgaagaaaccggctttagtgtcatc
aggatcaggtccaggggctttaacggcctggtaaccgttgtcggtaaccttgccgctgtc
agtgtgggagccgtcctgcgccttaagggcgaatggaaacacgacagcaaatacggaaag
caattcaatgcccacgactaccgagagacggttcccgctactgttgccgggattgaaaaa
tacctgggcagcggcctgatcaaaggtatcggaccggtttatgcccgcagaatcgtaaat
catttccgggaagacactctgagagtgatagaggaacaggccgaccgcctgcttgaggta
gaaggcatcggacaaaaacgggtggaaatgatcaaaaaagcatggcaggaacagaaggaa
atcaagaatgtcatgctgtttttacagagccacggggtatcagcctcttatgctgtgaag
atatataaaacctatgggaacgaaagtatcaatatcgttaaaaccaatccctaccgtctg
gcagatgatatctggggtatcggctttaaaacagccgacaagattgcccggcagctcggc
tttgacaagaactcttatgagcgctgccgctcagggattatctatgttttgaacgaactg
gccaatgaaggacactgctttgccgtacgggagcaactggtgtccgaaacggtcaaaata
cttgaactggaagagccaatggttaaatccactattgacaggatggtcgaggaaaagtgg
gttattcccgatgaaaacaacgctgtttatcttccgccgttctatttcagcgaaaccggc
actgccaaaagaatcaaagaaatcctggccgttcaggcccctgaaccggcagtggatata
gaacgggtcatcaaagaggtgcaggcggaatgcggtattacttatgatgaagtccaattg
gaagctatcaagacagcggttacatccaagttcatggtcctgacaggcggtcccggaacc
gggaaaaccactgccactcttgccatcatcagggtatttcagaaactgggcgcttcatgt
atactggcagcccccaccgggagagctgccaaaagattgtccgagaccaccggcatggaa
gccaaaaccatccaccggctgctggagtataagcctcccgagggctacaggcgtaacggc
gagaatcccctggagtgcgatgtgctggttgtcgatgaaacatcaatggttgatattatc
ctgatgtacaatttactgaaagcggtatccaatgaaaccgtcgtcattcttgcgggtgat
gtggaccagcttccgtcggtgggcgccggtaatgtcctgaaagatattattgattccgga
accgtacctgtggtccggctgaccaggattttccgccaggccatgggcagcgccattatc
accaatgcccaccggattaacaggggagaaatgcccaacctcaggggcgggcggaacagc
gacttcttctttattgaagaggaggacccgctgaaagtgacggagactgtcaaagacctc
tgcaccaaaaggctgccgggatactataagattgatccgattaacgacatccaggtttta
tgccccatgcagcggggaggaaccggagcccagaatttgaacaccgtgctgcaggaagct
ttgaatccgaccaatgtcaccatcaaatacggaggaacggtatttcggttaaacgacaag
gtaatgcagataaaaaacaactatgaaaaaaatgtatttaacggcgacatcggtaccatt
gtcaaaattgatatggaggacaaaaccctggttattcggtttgacggaaatgatgtggat
tatgatgccaccgaattggatgaagtagtcctggcctatgctaccaccgtgcacaaaagc
cagggcagtgaatataaggttgtagttgccccgttcaccatgcagcattacatgatgtta
cagagaaacctgctgtatacctgtgtcacgagggcaaagcaggtctttgtcctggtgggt
tcgaagaaggcggtagctatagcggtgtcgaacaataaaattcagcggcgcaataccatg
ctggccaaaaggctggctcaactcggctaa

DBGET integrated database retrieval system