KEGG   Thermincola potens JR: TherJR_0603Help
Entry
TherJR_0603       CDS       T01226                                 

Definition
Arginase/agmatinase/formiminoglutamase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
tjr  Thermincola potens JR
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:tjr00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
600430..601533
Genome map
AA seq 367 aa AA seqDB search
MGFFHKEHFEGIQAANAEAKIPDTKWKEEIRRSLEYGLEAADSIQDRNISCFSRGELPHF
AGINTLLKVPYLEDVRKVGEYDVAFMGVPHDCGTTYRSGTRFGPQAMRRISALYTPYYFE
MGVDLRESLKMCDVGDVFTINANNEKSFDQISKAVSHVFASGAMPMIMGGDHSIGYPCVR
GIAPHIDGNIGIIHLDRHADTQEKDMDERMHTCPWFHATNIPNAPAVNLVQIGIGGWQVP
RDGVKVARERGTTIISVADCEKIGIEKVAEIALEVAWKGAKAVYLSFDIDCVDAGFVPGT
GWPEPGGFLPREALKLLQLVAKEGICAMEVVEVSPPYDISDITAQLGVRAMLDVLATMVA
NGKLPKK
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgggattttttcataaggaacatttcgaagggatacaggcagccaatgccgaggcgaaa
atacctgataccaagtggaaagaggaaatccggcggagtctggaatacgggctggaggcc
gctgacagcatacaagacaggaatataagctgcttctctcgcggtgaattgccgcacttc
gcgggaatcaacacattgctcaaggtaccgtacctggaagacgtccgcaaagtgggtgaa
tatgacgtggccttcatgggcgtgcctcatgactgcggcacaacttaccggtcgggcacc
aggtttggcccccaggctatgaggcggatttcggccttatatacaccgtactattttgag
atgggtgttgaccttcgtgagtccctgaagatgtgtgatgtaggtgatgtctttacgatt
aacgccaataacgaaaaaagctttgaccagatttccaaggcagtgtcccacgtttttgcc
agtggtgccatgcccatgataatgggtggagaccattccatcggttatccttgtgtaagg
ggtattgccccgcatattgacggcaacatagggattatccacctggacaggcatgccgat
acccaggaaaaggatatggacgagaggatgcatacctgcccgtggtttcatgcaaccaat
attcccaatgccccggctgttaacctggtccagatcggcattggcggttggcaggtgccg
cgcgacggtgtgaaagttgctcgcgagaggggaacaactataatttctgtggccgattgt
gaaaagataggtatcgaaaaagtggccgaaatagccctcgaggtggcctggaaaggggca
aaagcggtttatttgagttttgacattgattgtgttgatgctggttttgttcctgggacc
gggtggccggagccgggtggattcctaccgcgagaagcattgaaactgcttcaactggta
gccaaggaaggaatttgtgccatggaagtggtggaggtttcaccaccgtatgatattagt
gatattacagcccagttgggtgtgagggccatgcttgatgtactcgctactatggtggct
aatggcaaacttcccaaaaagtaa

DBGET integrated database retrieval system