KEGG   Thermincola potens: TherJR_0836Help
Entry
TherJR_0836       CDS       T01226                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
tjr  Thermincola potens
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:tjr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TherJR_0836
  Amino acid metabolism
   00340 Histidine metabolism
    TherJR_0836
Enzymes [BR:tjr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     TherJR_0836
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
841764..843059
Genome map
AA seq 431 aa AA seqDB search
MIRILKSGQAEVEKVLNKVYEDQAVYEQRVSEILKEVRERGDEAVLEYTARFDKARLTPE
NLRVSAEEIEEAYRVIDKDVLPALQKARDNIAAYHEKQLQKCWFDPEEDGTVLGQLVRPL
ERVGIYVPGGTASYPSSVLMNAVPAKVAGVKEIVMVAPPTAGGRIDPYSIVAAAEAGVTE
IYKVGGAQAVAALAYGTRTIRKVDLITGPGNIYVTLAKKMVYGQVNIDMLAGPSEILIIA
DASADPTYVAADLLSQAEHDVLASAVLVTPSEKLAHAVKAEIERQVSYLSRKEILTASLR
DYSAIIVTDSLAEAIEMANTYAPEHLELAVEKPFDILGKIKNAGAVFMGHYTAEPVGDYY
AGPNHVLPTGGTARFYSPLNVDTFMKKMSIIAYSRDRLEKVGQDIVKLAKVEGLDAHANS
IQVRLDKLAKK
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgatcagaattttgaaaagcggccaggccgaggtggaaaaggtattaaacaaagtatat
gaagaccaggccgtttatgaacagcgggtaagcgaaattttaaaggaggtacgggagaga
ggcgacgaggctgtgctggaatacacggctcgcttcgataaagcccgcttaacgccggaa
aatttacgggtttcggcagaagaaatcgaagaagcttaccgggttattgataaagatgtt
ttgcctgccctgcaaaaggcccgcgacaatattgccgcttatcacgaaaaacaactgcaa
aagtgttggtttgacccagaagaggacggcactgtcctggggcagttggtacgccccctg
gaacgggtcggtatctacgtacccgggggtacggcctcctatccttcttctgtgctgatg
aatgccgtgccggcaaaggtggcgggagttaaagagattgttatggtcgctcccccgacg
gccgggggccggattgatccctattcgatagttgctgcggcggaggccggagttacggaa
atatataaggttggcggcgcccaggccgtggcggcgctggcttacgggacccggaccata
aggaaggttgaccttattacaggccccggtaacatatacgttaccctggccaagaagatg
gtttacggccaggtaaatatagacatgctggcgggaccgagcgaaatcttgatcatcgca
gatgcctcagcagatcccacttatgtggcggctgacctgctttcccaggctgagcacgat
gtgcttgcttcggcagttttagttactccttccgaaaaattggcccatgccgtaaaagca
gaaattgagcgccaggtatcatatttgtccaggaaagagattttaacggcttctttgcgg
gactacagcgccattattgtgactgacagccttgccgaagccattgaaatggccaacact
tatgcgcccgaacacctggaactggccgtggaaaagccttttgacattttgggaaaaatc
aaaaacgccggcgctgttttcatgggtcattacacggccgaacctgtgggcgactattac
gccggtcccaaccatgtactgcccacaggcggtacggcccgcttttattctccgttaaac
gtggacacctttatgaaaaaaatgagtattattgcctattcccgggatcgcctggaaaaa
gtgggccaggacattgtcaaactggcgaaagtggagggtttggacgcccacgccaattcc
atccaggtaaggttggataaattagcaaaaaaataa

DBGET integrated database retrieval system