KEGG   Thermincola potens: TherJR_0836Help
Entry
TherJR_0836       CDS       T01226                                 

Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
tjr  Thermincola potens
Pathway
tjr00340  Histidine metabolism
tjr01100  Metabolic pathways
tjr01110  Biosynthesis of secondary metabolites
tjr01230  Biosynthesis of amino acids
Module
tjr_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:tjr00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    TherJR_0836
Enzymes [BR:tjr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     TherJR_0836
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: ADG81703
JGI: TherJR_0836
UniProt: D5XD55
Position
841764..843059
Genome map
AA seq 431 aa AA seqDB search
MIRILKSGQAEVEKVLNKVYEDQAVYEQRVSEILKEVRERGDEAVLEYTARFDKARLTPE
NLRVSAEEIEEAYRVIDKDVLPALQKARDNIAAYHEKQLQKCWFDPEEDGTVLGQLVRPL
ERVGIYVPGGTASYPSSVLMNAVPAKVAGVKEIVMVAPPTAGGRIDPYSIVAAAEAGVTE
IYKVGGAQAVAALAYGTRTIRKVDLITGPGNIYVTLAKKMVYGQVNIDMLAGPSEILIIA
DASADPTYVAADLLSQAEHDVLASAVLVTPSEKLAHAVKAEIERQVSYLSRKEILTASLR
DYSAIIVTDSLAEAIEMANTYAPEHLELAVEKPFDILGKIKNAGAVFMGHYTAEPVGDYY
AGPNHVLPTGGTARFYSPLNVDTFMKKMSIIAYSRDRLEKVGQDIVKLAKVEGLDAHANS
IQVRLDKLAKK
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgatcagaattttgaaaagcggccaggccgaggtggaaaaggtattaaacaaagtatat
gaagaccaggccgtttatgaacagcgggtaagcgaaattttaaaggaggtacgggagaga
ggcgacgaggctgtgctggaatacacggctcgcttcgataaagcccgcttaacgccggaa
aatttacgggtttcggcagaagaaatcgaagaagcttaccgggttattgataaagatgtt
ttgcctgccctgcaaaaggcccgcgacaatattgccgcttatcacgaaaaacaactgcaa
aagtgttggtttgacccagaagaggacggcactgtcctggggcagttggtacgccccctg
gaacgggtcggtatctacgtacccgggggtacggcctcctatccttcttctgtgctgatg
aatgccgtgccggcaaaggtggcgggagttaaagagattgttatggtcgctcccccgacg
gccgggggccggattgatccctattcgatagttgctgcggcggaggccggagttacggaa
atatataaggttggcggcgcccaggccgtggcggcgctggcttacgggacccggaccata
aggaaggttgaccttattacaggccccggtaacatatacgttaccctggccaagaagatg
gtttacggccaggtaaatatagacatgctggcgggaccgagcgaaatcttgatcatcgca
gatgcctcagcagatcccacttatgtggcggctgacctgctttcccaggctgagcacgat
gtgcttgcttcggcagttttagttactccttccgaaaaattggcccatgccgtaaaagca
gaaattgagcgccaggtatcatatttgtccaggaaagagattttaacggcttctttgcgg
gactacagcgccattattgtgactgacagccttgccgaagccattgaaatggccaacact
tatgcgcccgaacacctggaactggccgtggaaaagccttttgacattttgggaaaaatc
aaaaacgccggcgctgttttcatgggtcattacacggccgaacctgtgggcgactattac
gccggtcccaaccatgtactgcccacaggcggtacggcccgcttttattctccgttaaac
gtggacacctttatgaaaaaaatgagtattattgcctattcccgggatcgcctggaaaaa
gtgggccaggacattgtcaaactggcgaaagtggagggtttggacgcccacgccaattcc
atccaggtaaggttggataaattagcaaaaaaataa

DBGET integrated database retrieval system