KEGG   Thermincola potens: TherJR_0934Help
Entry
TherJR_0934       CDS       T01226                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
tjr  Thermincola potens
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:tjr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TherJR_0934
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TherJR_0934
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    TherJR_0934
Enzymes [BR:tjr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     TherJR_0934
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
949484..950983
Genome map
AA seq 499 aa AA seqDB search
MNYISTRGNFEAVSSARAIKLGMVPTGGLFVPEFLPVLSMNDLANMVNCSYQEVAEKVLG
LYLTDYSAEEIRECIDRAYNGQNFDTPEIAPLFQLNNHTYFLELWHGPTAAFKDMALQIM
PPLLSKAVKKVQSDKEIVILVATSGDTGKAALEGYKNVPGIRIIVFYPYGGVSKVQELQM
TTTDGNNTYVVAVKGNFDDCQNAVKEIFGDPDYNHFLNEHGIELSSANSINWGRLVPQII
YYIWSYLSLVRQGQINMGDKINIVVPTGNFGNILAGYYAYRMGLPVNKFICASNENKVLT
DFFRTGEYDRNREFIKTNSPSMDILISSNLERFLFEVNGHNSELINKWFRELNATGVFNI
DAETRARIDAILAAGFATEEETLATIREVFEKKHYTVDTHTAVALKVYWDYVKSTKDHTP
TVIASTANPFKFNAAVLEAIKGPEAIAGKDEMAILQELREVSGMEIHPGLRDLDKKPVRH
NRVAAKEELVQEINNILGV
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgaactacataagtacaaggggcaactttgaagctgttagctccgcccgggcaatcaaa
ctgggcatggttccgacgggcggcctttttgttcccgaattccttcctgtactatccatg
aatgacctggcgaacatggttaactgttcttatcaggaagtggcggaaaaggttttggga
ctttacctcactgattattctgcagaggaaatccgggagtgcatagacagggcttacaac
ggtcaaaattttgatacccccgaaatagcgcctttatttcagttaaataaccatacctat
tttctggagctctggcatggcccaacagcggcttttaaggatatggccctgcaaataatg
cctcccttattatccaaggctgtgaaaaaagtacagtcagacaaggaaatagttattttg
gtggccacatcgggtgatacgggcaaagcggccctggaaggttataaaaacgttccaggc
atcagaatcattgttttctacccttacgggggggtcagcaaggtgcaggaactgcagatg
acaaccaccgatgggaataacacatacgttgtagctgtaaagggtaatttcgatgattgc
cagaatgccgtgaaagaaatttttggcgacccggattacaaccattttctgaatgaacac
ggcattgagttatcttcagccaactccatcaactgggggcgtctggtaccgcaaattatt
tactatatatggagctacctgtctctggtcagacaaggtcagataaatatgggggataaa
atcaatatagttgttcccacgggtaacttcggcaatatcctggccggctactatgcttac
cgcatgggtctgcctgtcaacaagttcatatgtgcttccaatgaaaacaaggttttgact
gactttttccgtacaggtgaatatgaccgtaaccgggagtttataaagacaaacagtcct
tctatggatattttgatttccagcaatctggagaggttccttttcgaagttaacgggcat
aacagcgaattaataaacaaatggttcagagagctgaatgcaacgggtgtttttaacatt
gatgcggaaaccagggccagaattgacgccatactggcagccggctttgctaccgaagaa
gaaactctggccacaataagagaagtgtttgagaaaaaacactataccgttgacacccat
acggccgttgccctgaaagtatactgggactatgttaaatctaccaaagaccatacgccg
acggtaattgcttccaccgccaatccgtttaaatttaatgctgcggtgctggaagctatc
aaagggccggaagctatcgccggcaaggatgaaatggcaatcctgcaagagttgcgggaa
gtttccggcatggaaatccaccccggcctgcgcgacttggacaaaaaacctgtccggcat
aacagagtggcggctaaggaagaactggttcaggaaataaacaacatcctgggcgtataa

DBGET integrated database retrieval system