KEGG   Thermincola potens: TherJR_0934Help
Entry
TherJR_0934       CDS       T01226                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
tjr  Thermincola potens
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:tjr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TherJR_0934
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TherJR_0934
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    TherJR_0934
Enzymes [BR:tjr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     TherJR_0934
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
949484..950983
Genome map
AA seq 499 aa AA seqDB search
MNYISTRGNFEAVSSARAIKLGMVPTGGLFVPEFLPVLSMNDLANMVNCSYQEVAEKVLG
LYLTDYSAEEIRECIDRAYNGQNFDTPEIAPLFQLNNHTYFLELWHGPTAAFKDMALQIM
PPLLSKAVKKVQSDKEIVILVATSGDTGKAALEGYKNVPGIRIIVFYPYGGVSKVQELQM
TTTDGNNTYVVAVKGNFDDCQNAVKEIFGDPDYNHFLNEHGIELSSANSINWGRLVPQII
YYIWSYLSLVRQGQINMGDKINIVVPTGNFGNILAGYYAYRMGLPVNKFICASNENKVLT
DFFRTGEYDRNREFIKTNSPSMDILISSNLERFLFEVNGHNSELINKWFRELNATGVFNI
DAETRARIDAILAAGFATEEETLATIREVFEKKHYTVDTHTAVALKVYWDYVKSTKDHTP
TVIASTANPFKFNAAVLEAIKGPEAIAGKDEMAILQELREVSGMEIHPGLRDLDKKPVRH
NRVAAKEELVQEINNILGV
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgaactacataagtacaaggggcaactttgaagctgttagctccgcccgggcaatcaaa
ctgggcatggttccgacgggcggcctttttgttcccgaattccttcctgtactatccatg
aatgacctggcgaacatggttaactgttcttatcaggaagtggcggaaaaggttttggga
ctttacctcactgattattctgcagaggaaatccgggagtgcatagacagggcttacaac
ggtcaaaattttgatacccccgaaatagcgcctttatttcagttaaataaccatacctat
tttctggagctctggcatggcccaacagcggcttttaaggatatggccctgcaaataatg
cctcccttattatccaaggctgtgaaaaaagtacagtcagacaaggaaatagttattttg
gtggccacatcgggtgatacgggcaaagcggccctggaaggttataaaaacgttccaggc
atcagaatcattgttttctacccttacgggggggtcagcaaggtgcaggaactgcagatg
acaaccaccgatgggaataacacatacgttgtagctgtaaagggtaatttcgatgattgc
cagaatgccgtgaaagaaatttttggcgacccggattacaaccattttctgaatgaacac
ggcattgagttatcttcagccaactccatcaactgggggcgtctggtaccgcaaattatt
tactatatatggagctacctgtctctggtcagacaaggtcagataaatatgggggataaa
atcaatatagttgttcccacgggtaacttcggcaatatcctggccggctactatgcttac
cgcatgggtctgcctgtcaacaagttcatatgtgcttccaatgaaaacaaggttttgact
gactttttccgtacaggtgaatatgaccgtaaccgggagtttataaagacaaacagtcct
tctatggatattttgatttccagcaatctggagaggttccttttcgaagttaacgggcat
aacagcgaattaataaacaaatggttcagagagctgaatgcaacgggtgtttttaacatt
gatgcggaaaccagggccagaattgacgccatactggcagccggctttgctaccgaagaa
gaaactctggccacaataagagaagtgtttgagaaaaaacactataccgttgacacccat
acggccgttgccctgaaagtatactgggactatgttaaatctaccaaagaccatacgccg
acggtaattgcttccaccgccaatccgtttaaatttaatgctgcggtgctggaagctatc
aaagggccggaagctatcgccggcaaggatgaaatggcaatcctgcaagagttgcgggaa
gtttccggcatggaaatccaccccggcctgcgcgacttggacaaaaaacctgtccggcat
aacagagtggcggctaaggaagaactggttcaggaaataaacaacatcctgggcgtataa

DBGET integrated database retrieval system