KEGG   Thermincola potens: TherJR_1111Help
Entry
TherJR_1111       CDS       T01226                                 

Definition
iron-containing alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
tjr  Thermincola potens
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:tjr00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    TherJR_1111
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TherJR_1111
   00620 Pyruvate metabolism
    TherJR_1111
   00650 Butanoate metabolism
    TherJR_1111
  Lipid metabolism
   00071 Fatty acid degradation
    TherJR_1111
  Amino acid metabolism
   00350 Tyrosine metabolism
    TherJR_1111
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    TherJR_1111
   00626 Naphthalene degradation
    TherJR_1111
Enzymes [BR:tjr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     TherJR_1111
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     TherJR_1111
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1165607..1168315
Genome map
AA seq 902 aa AA seqDB search
MEQKDVSIDRRLVSQEIDALVRNAQEAQMEFYRFNQEQVDKIVKAMALAGLDHHMELARL
AVEETGRGVYEDKITKNIFATESVYHSIKYHKTVGIIHVNEEEDYMEVAEPVGVIAGITP
VTNPSSTTMFKSLIAMKTRNPIIFSFHPGSQKTCVTAAKIMRDAAVQAGAPANCISWIEH
PSIEAANMLMHHPGVSLILATGGASMVKAAYSAGKPALGVGPGNVPCYIEQSANLKRAVT
DIIMSKTFDNGMICASEQGLFVDSAVSNQVMRLLADNGCYFLAPEEVKRLEDFATCQHSC
SLNPDIVGQSAFKIAQMAGISVPGDTKILIAVLEGIGPEYPLSREKLSPILAYYTVSDFR
EGITRAEEMVEFGGLGHSAVIHSENQAVINEFAKRVRVGRVIVNAPATHGAIGELYNTNM
PSLTLGCGSMGHNSTTSNVSAVNLVNIKRVARRRVKMQWFRVPERIYFESGSVQYLAKMP
NVNRAIIVCDPAMVEHGYVEKVIYHLNKRENHVAIEIFSDVEPDPSVETVMKGCEIMRRF
QPDTIIALGGGSALDAAKGMWLFYEYPDVEFEFLKLKFLDIRKRTYKYPKLGRRAKMVAI
PTTSGTGSEVTAFAVITDKGRAVKYPLADYELTPDVAIVDFDFVMSVPPAVTADTGMDVL
THAIEAYVSVMASDYTDGLALKAIELVFQYLPRAYKNGSDRVAREKMHNASTIAGMAFTN
AFLGINHSLAHKLGGEFHIPHGRANAILLPYVIEYNAQRPTKFVSWPKYEYYVAPEKYQR
IARYLGLPASSVEEGVASLIQAIRRLMKELNMPSTIGECGVDPDEFIRKLPMLAEKAFED
QTTVTNPRMPLIEELKEIYIKAFGPPLSQSQPFAPQTDNHYKQVRAADNSKPMGEEFHSR
LN
NT seq 2709 nt NT seq  +upstreamnt  +downstreamnt
atggaacagaaagatgtttctattgacaggcgcctggtttctcaggagattgatgccctg
gtcagaaatgcccaggaggcgcaaatggaattctacaggtttaaccaggagcaggttgat
aaaattgttaaagcaatggctctggcgggattggaccaccatatggaactggccaggttg
gctgttgaagaaacgggccgtggcgtttatgaggacaagattaccaaaaatatatttgcc
acggagtctgtgtaccacagcattaaataccataaaactgttggcataatacatgtaaac
gaagaggaagattacatggaagtggcagaacctgtaggtgtgatagcgggcataacaccg
gtaacaaacccgtcttccactacgatgtttaagtcactgattgccatgaaaacacgcaat
cccattattttcagctttcacccgggatcccagaaaacctgtgttacggcagccaaaatt
atgcgggatgctgctgtacaggccggggcgccggctaactgtataagctggatagaacac
ccttccatagaagcggccaatatgttgatgcaccatcccggagtttctctgatcctggcc
acaggaggggcctccatggtcaaagcggcgtacagcgccggcaaacctgccctgggcgtg
gggccgggtaatgtgccgtgttatatagagcaaagcgcaaatttaaagagagcagtcacg
gatatcattatgagtaagacctttgacaacggcatgatttgcgcatcggagcaaggcctg
tttgtagacagcgctgtcagtaaccaggttatgcggctgttggcagacaacggttgttac
ttcctggcgccggaggaagtcaaaaggctggaggattttgccacctgccagcacagttgc
tcgttaaaccctgatatagttgggcagtcagcctttaagatagcccaaatggcaggtatt
tcggtacccggggataccaagatactgatagctgttctggaaggtatcggcccggaatat
cccctgtcacgggaaaagctgagccctattttggcctattatacggtcagtgatttccgg
gaagggattacccgggccgaagaaatggtggaatttggcggtttggggcattcggcggtt
atacattcggaaaaccaggctgtcattaacgaatttgccaaaagggtccgtgtaggccgg
gtgatagttaatgctcccgctacccatggcgccattggggagttatacaataccaatatg
ccgtctctgacgctgggctgcggttccatgggccacaattccactacttcaaatgtcagc
gctgtaaacctggtgaatatcaaaagggtggccaggaggagagtaaaaatgcagtggttc
agggttccggagcggatatactttgagtccgggtcagtacaatacctggcgaaaatgccc
aatgtaaacagggcgattatagtctgcgatccggctatggtggaacatggttatgtagaa
aaagtgatatatcatttaaataaaagggaaaaccatgtggccattgaaattttttccgac
gttgaacccgatccttctgtggaaacggtgatgaagggctgtgaaataatgcggcgcttt
cagcctgatacgataattgctctgggcggcggttcggccctggatgcggccaaaggtatg
tggttgttttacgaataccccgatgtcgaatttgagtttctcaaactcaagtttcttgat
attcgcaaacgtacttataagtacccgaaactgggccgcagagcaaaaatggtggccatt
cccactaccagcggtacgggttcggaagtaacggcttttgcggttattaccgataaagga
cgggctgttaagtatcctctggctgattacgaattaactcctgatgtggccatcgtggac
tttgactttgtcatgtcggtaccgcctgctgttacggcagatacgggtatggatgttctg
acccatgctatcgaagcttacgtttcggtcatggcttccgattataccgacggtttggct
ttaaaggctatcgaactggtcttccagtacctgccaagagcttataagaacggctccgac
cgggtggcgcgggaaaaaatgcataatgcttctactattgccggcatggcttttaccaat
gcttttttagggataaaccacagtctggcccataaactgggcggagagtttcatattccc
catggccgggccaatgctatcctgctgccttatgttatcgaatacaatgctcagcgaccc
accaaatttgtttcctggcccaagtatgagtactatgttgcgcccgaaaaatatcagagg
attgccaggtatctgggactgccggcaagcagtgtggaagagggcgtagccagtctgatt
caggctatccggcgattgatgaaggaactcaatatgccgtcaactataggtgaatgcggc
gtcgatcccgacgaatttatccgcaaactgccgatgctggcggaaaaagcttttgaggac
cagacgactgttaccaatcccaggatgcccctgatagaagaattaaaagaaatttatatt
aaggcctttggacctccgctgagccaatcccagccctttgcgcctcagacggacaaccat
tataaacaggtaagggctgcggataactccaagcctatgggagaagaattccatagtaga
ttaaattga

DBGET integrated database retrieval system