KEGG   Thermincola potens: TherJR_1181Help
Entry
TherJR_1181       CDS       T01226                                 

Definition
(GenBank) Holliday junction DNA helicase RuvA
  KO
K03550  holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
tjr  Thermincola potens
Pathway
tjr03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:tjr00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    TherJR_1181
Enzymes [BR:tjr01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     TherJR_1181
DNA repair and recombination proteins [BR:tjr03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     TherJR_1181
    RecFOR pathway proteins
     TherJR_1181
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuvA_N HHH_5 RuvA_C HHH HHH_2 Transposase_20 HHH_3 5_3_exonuc HHH_8 IMS_HHH UBA
Motif
Other DBs
NCBI-ProteinID: ADG82045
JGI: TherJR_1181
UniProt: D5XEH4
Position
1251262..1251864
Genome map
AA seq 200 aa AA seqDB search
MMISFLRGELNYIGEDYIIIDVHGVGYKVYVPASFIGKLPACGQPVTVFTHLYVREDVMQ
LYGFPDREELELFEVLLQVSGIGPKVAVSVLSAVPASSFKQAIVNEQVGVLTQVPGIGKK
TAQRMILELKDKLGKLPGRGQAPPVSANFAPNTEEAVQALIALGYAPNEARKAVNKVVNT
HPELGVEESIKKALLELARF
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgatgatatcttttttaagaggagaactgaattatattggcgaagactacataatcatt
gatgtgcacggggttggatacaaggtttatgttccggcgtcgtttatcggtaaactccct
gcctgcggccagccggtaacagtatttacccatttatatgtccgggaagatgttatgcag
ctatacggttttccggatagagaagaattggagctttttgaagttctcctccaggtttcc
ggaataggaccaaaggtagctgtttccgttctttctgctgtacccgcctcttcttttaag
caggctattgtaaatgaacaggtaggagtacttacgcaggtcccggggataggtaagaaa
acagcccagcggatgatattggaattaaaagataaattaggtaaattgccgggaagaggt
caggccccgcctgtttctgctaattttgctcccaacaccgaggaggcagttcaggccctg
atagctttgggctatgcccccaatgaggccagaaaggctgtcaacaaagtagttaacact
catcctgagctgggagtggaagagtccataaagaaagccttgctggaattggccaggttc
taa

DBGET integrated database retrieval system