KEGG   Thermincola potens: TherJR_1181Help
Entry
TherJR_1181       CDS       T01226                                 

Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
tjr  Thermincola potens
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:tjr00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    TherJR_1181
Enzymes [BR:tjr01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     TherJR_1181
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1251262..1251864
Genome map
AA seq 200 aa AA seqDB search
MMISFLRGELNYIGEDYIIIDVHGVGYKVYVPASFIGKLPACGQPVTVFTHLYVREDVMQ
LYGFPDREELELFEVLLQVSGIGPKVAVSVLSAVPASSFKQAIVNEQVGVLTQVPGIGKK
TAQRMILELKDKLGKLPGRGQAPPVSANFAPNTEEAVQALIALGYAPNEARKAVNKVVNT
HPELGVEESIKKALLELARF
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgatgatatcttttttaagaggagaactgaattatattggcgaagactacataatcatt
gatgtgcacggggttggatacaaggtttatgttccggcgtcgtttatcggtaaactccct
gcctgcggccagccggtaacagtatttacccatttatatgtccgggaagatgttatgcag
ctatacggttttccggatagagaagaattggagctttttgaagttctcctccaggtttcc
ggaataggaccaaaggtagctgtttccgttctttctgctgtacccgcctcttcttttaag
caggctattgtaaatgaacaggtaggagtacttacgcaggtcccggggataggtaagaaa
acagcccagcggatgatattggaattaaaagataaattaggtaaattgccgggaagaggt
caggccccgcctgtttctgctaattttgctcccaacaccgaggaggcagttcaggccctg
atagctttgggctatgcccccaatgaggccagaaaggctgtcaacaaagtagttaacact
catcctgagctgggagtggaagagtccataaagaaagccttgctggaattggccaggttc
taa

DBGET integrated database retrieval system