KEGG   Thermincola potens: TherJR_1365Help
Entry
TherJR_1365       CDS       T01226                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
tjr  Thermincola potens
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tjr00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    TherJR_1365
Enzymes [BR:tjr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     TherJR_1365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1426801..1427946
Genome map
AA seq 381 aa AA seqDB search
MKNIAIIGSTGSIGTQTLEVIDLFPDHFNVVALAAGSNTELLAEQAARYRPQLVCIGQKD
LYHDLKEKIGHLECKVTAGPEGLVEVATFSKADVVVTSITGALGLVPTVEAIKSGKNIAL
ANKETLVAAGDIVMALAHEYGVKILPVDSEHSAIFQCLNGEDNRRISKLILTASGGPFRG
KNRSQLVDIGPEDALRHPNWSMGAKITVDSATLMNKGLEVIEAKWLFGVDLSNIDVVIHP
QSVIHSMVEFVDGSIIAQLGLPDMKLPIQYALTYPQREPNNFPRLDLSQIRNLTFEEPDR
QTFSCLDIAFAAARKGGTMPAVMNAANEEAVALFLKKKIKFLDIPNIILKVMERHRLIEK
PQLSQILECDAWARQEVYTLL
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaatattgctattataggaagtaccggttctataggcacccaaacactggaagtc
atagatttatttccagatcattttaatgtagttgccctggcggcaggctccaacacggag
ctgctggcagagcaggcggccaggtacaggccccaactggtttgcataggccaaaaagat
ctttatcatgacctgaaagaaaaaatagggcatctggaatgtaaagttaccgctggcccg
gaggggctggtggaagttgctacctttagcaaagcagatgtagtggttacatctattaca
ggcgctttagggcttgttccgacggtagaagctataaaatccggtaaaaatattgccctg
gctaataaggaaactctggttgctgccggggatatcgtgatggctttggcccatgagtac
ggggtaaagatactgcctgtcgacagtgaacattccgccatttttcagtgcctgaacggg
gaagataaccggcgaatcagcaaattaatccttacggcgtcgggggggccgttccgggga
aaaaaccggtcgcagcttgttgatatcggtccggaagatgccttgcggcaccctaactgg
tccatgggcgctaaaattactgttgattccgctactttaatgaataaagggcttgaggtt
atcgaagccaagtggttgtttggcgtggatttatccaacattgacgtggtcattcatccc
cagagtgtaatccattcgatggtcgagtttgtcgatggttccataatcgcacagttagga
ctgccggatatgaagttgcctattcagtatgccttaacttatccgcagcgcgaacctaat
aattttccccggcttgatttgagccaaatcagaaacttaacctttgaagaaccggacagg
cagactttttcctgcttggatatagcctttgcggcggctaggaaaggaggaaccatgccg
gcggtaatgaatgcggccaatgaagaggcagtggcgctctttttaaagaaaaagataaag
ttcctcgatattccgaatataattctcaaggtaatggaaagacaccggttgatagaaaag
ccgcagttaagccagattctggaatgtgatgcctgggccagacaggaagtttacacgttg
ctgtaa

DBGET integrated database retrieval system