KEGG   Thermincola potens: TherJR_1601Help
Entry
TherJR_1601       CDS       T01226                                 

Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
tjr  Thermincola potens
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tjr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TherJR_1601
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TherJR_1601
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    TherJR_1601
Enzymes [BR:tjr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     TherJR_1601
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1665152..1665976)
Genome map
AA seq 274 aa AA seqDB search
MAYADEKTMLLENRIRQKFDNLARRGEKGLITFVTAGDPDLETTVRLVLEMEKAGADIVE
LGVPYSDPLADGPVIQKASLRALKNGTALKGIFGAVREVRKQSNIPLILMTYYNPVLRYG
LAAFAAEASTVGVDGVIVPDLPVEEAAPLERELTAQGLYLIPLVAPTSGAERIKRITAGD
RGFVYCVSLTGVTGIRQGVPPGLEDFLDCVRRNTANPLAVGFGVSHPEQAREIAKHCDAV
IVGSALVKTIEEYQNSPDLLVHVKNFVHSLKEAI
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atggcttatgctgatgaaaagaccatgctcttagaaaatagaataaggcagaaatttgat
aacctggccaggcgcggggaaaaaggccttataactttcgtcacggccggcgatcctgat
ctggaaactacagttcgcctagtgctggaaatggaaaaagccggcgccgacattgtggaa
ctgggcgtaccttattccgacccgttggctgacgggccggtcatacaaaaggcctctttg
cgggcgttaaaaaacggtactgccttaaagggaatttttggcgcagtacgggaagtcagg
aagcagagcaacatacctttaattttaatgacttattataatcctgttctcaggtacgga
ctggcggcatttgctgctgaagcctcaacggtgggagtagatggcgtcattgtgccggac
ctgcctgtagaagaagccgctcctttggaaagggaacttacggcccaagggttatatttg
attcccctggtcgcccccacaagcggggctgaacgtataaaacggattactgccggtgac
aggggttttgtttactgtgtatctctgacaggggtaacaggtatacggcagggggtgccg
ccaggcctggaggattttcttgactgtgtgcgaagaaataccgccaatccgctggcagta
gggtttggtgtttcccacccggaacaggcccgggaaattgcaaaacattgtgatgctgtc
atagttggcagcgctttggtaaaaactattgaagaatatcagaattcacctgatttgctg
gttcacgtaaaaaactttgttcatagcttaaaagaagcgatataa

DBGET integrated database retrieval system