KEGG   Thermincola potens: TherJR_1602Help
Entry
TherJR_1602       CDS       T01226                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
tjr  Thermincola potens
Pathway
tjr00260  Glycine, serine and threonine metabolism
tjr00400  Phenylalanine, tyrosine and tryptophan biosynthesis
tjr01100  Metabolic pathways
tjr01110  Biosynthesis of secondary metabolites
tjr01130  Biosynthesis of antibiotics
tjr01230  Biosynthesis of amino acids
Module
tjr_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tjr00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TherJR_1602
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    TherJR_1602
Enzymes [BR:tjr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     TherJR_1602
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ADG82454
JGI: TherJR_1602
UniProt: D5X784
Position
complement(1665979..1667166)
Genome map
AA seq 395 aa AA seqDB search
MQVLPDKNGYYGEFGGRFVPETLMPALFELEEAYLQYKNDPDFQAEFRKYLGEYVGRPSR
LYFARRLTDYCGGAKIYLKREDLNHTGAHKINNTIGQVLLARKMGKNRVVAETGAGQHGV
ATATAAALFGLECVVFMGEEDIKRQELNVFRMKILGARVQPVSSGSRTLKDAMNEAIRDW
VTNVRTTFYVLGSVGGPHPYPMIVRDLQSVIGLETRQQILELEGKLPDYLVACVGGGSNA
MGLFHPFLDTETKMIGVEAAGHGLHTPYHAATLTKGSKGVLHGAYSYLLQDDNGQILEAH
SVSAGLDYPGVGPEHSYLKETGRVTYTSVTDQEALEAFQVLCRTEGIIPALESSHALAET
LKLAPRLNGDQVVVVNLSGRGDKDVQTVAALLEVD
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtactgcctgataaaaacggatattacggggagtttggcggcaggtttgtcccg
gagacactcatgccggctcttttcgagctggaagaagcctatttacaatacaaaaatgat
cctgattttcaggccgaattcagaaaatatcttggcgaatatgtgggccggccctcgcgc
ctttactttgccagacggcttactgattactgcggtggcgcgaagatatatttaaaaagg
gaagacctgaaccataccggcgcccataagataaacaacaccatcggacaggtgctgctg
gccagaaaaatgggcaaaaatcgggtggttgccgaaacaggcgccggtcagcacggagtg
gctacagcgacggccgcagctctattcggcctggaatgcgttgttttcatgggtgaagaa
gacataaaaagacaggaactgaatgttttccggatgaaaatcctgggggctcgggtgcaa
cctgtgtcttccggcagcaggaccttaaaagatgctatgaatgaggccattagggactgg
gttaccaatgtccggactactttctatgttttgggatcagtaggcggaccccatccctat
cctatgatcgtgcgggacctgcagtcagtaattgggctggagaccaggcagcaaattctg
gaattggaaggaaagctgcctgattatctggtagcctgcgtaggaggcggtagtaatgcc
atgggtttgtttcatccgtttctggatacggaaacgaagatgattggggtcgaggctgcg
ggacacggacttcatacaccttatcatgcggctacattgacgaagggcagcaaaggggtc
ttgcacggggcttacagctacctgctgcaagacgataacggccagattttggaagcccat
tctgtttcggccggtcttgattatccgggggttggaccggaacacagctacttaaaagaa
acaggtcgtgtgacatatacatctgttacggaccaggaggctctggaggcttttcaggtc
ctatgccggacggaaggaattataccggccctagaaagttcccatgccctggcggagact
ttaaaactggctcccaggttaaacggggatcaggtcgtggtggtaaacctttccgggcga
ggcgacaaagatgttcagacggtggcggctttactggaggtggactag

DBGET integrated database retrieval system