KEGG   Thermincola potens: TherJR_1604Help
Entry
TherJR_1604       CDS       T01226                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
tjr  Thermincola potens
Pathway
tjr00400  Phenylalanine, tyrosine and tryptophan biosynthesis
tjr01100  Metabolic pathways
tjr01110  Biosynthesis of secondary metabolites
tjr01130  Biosynthesis of antibiotics
tjr01230  Biosynthesis of amino acids
Module
tjr_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tjr00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    TherJR_1604
Enzymes [BR:tjr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     TherJR_1604
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS His_biosynth NanE FMN_dh
Motif
Other DBs
NCBI-ProteinID: ADG82456
JGI: TherJR_1604
UniProt: D5X786
Position
complement(1667776..1668570)
Genome map
AA seq 264 aa AA seqDB search
MILDRILTEKKQEVKLAKTLKSMTEMKQSLAALPPARSLVKALDNRPAIGLIAEIKKGSP
SKGIIRADFDPVEIAKVYTASGAAAISILTDEKFFFGSSAYLQAVRKVTDLPLLRKDFII
DPWQVYESRCLGADLILLIAAALDDKMLPELFDLATELGMECLVEIHSEEEYERVKGLPL
HLLGINNRDLQTFQTDLNTTVNLCGKIRDSKGCKIVSESGIKNGNDVKFLKSHGVDAVLV
GESLMREKDIRQKVLELLGWEGVA
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgatattagataggattctcactgagaaaaagcaggaagtgaaattagcaaaaaccctt
aaatcaatgacggaaatgaaacagagcctggctgctttgccccctgccaggtctctcgta
aaagcgctggataataggcctgcaataggattaatagcggaaataaaaaaaggttctcct
tccaaaggtattatcagggcagattttgaccccgttgagatagctaaagtttatacggct
tccggagcggcagccatttcaattctcaccgatgaaaagtttttcttcggcagttctgct
tacctgcaggccgtgcgaaaagttaccgacctgccgctcttgcgcaaggattttatcatt
gacccctggcaggtttatgaaagccgctgcctgggagctgacctgatcctgctaattgca
gctgctttggatgataagatgctccccgagttatttgatctggcgacagaactgggcatg
gaatgcctggtggagattcattcggaagaagaatatgagcgggtcaaagggctgcccctg
cacctcttggggatcaataaccgggacttgcaaacctttcagactgacctcaatactacc
gttaatctctgcggcaagatacgggattccaaagggtgtaaaattgtcagtgaaagcggc
attaaaaacggtaatgatgttaaatttttaaagagccacggtgtggatgccgttttggtg
ggcgagtcattgatgcgggaaaaggatattcggcaaaaagttcttgaactgctgggatgg
gagggggttgcctga

DBGET integrated database retrieval system