KEGG   Thermincola potens: TherJR_1681Help
Entry
TherJR_1681       CDS       T01226                                 

Definition
(RefSeq) AMP-dependent synthetase and ligase
  KO
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
tjr  Thermincola potens
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tjr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TherJR_1681
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TherJR_1681
   00620 Pyruvate metabolism
    TherJR_1681
   00640 Propanoate metabolism
    TherJR_1681
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    TherJR_1681
   00680 Methane metabolism
    TherJR_1681
Enzymes [BR:tjr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     TherJR_1681
Lipid biosynthesis proteins [BR:tjr01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   TherJR_1681
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1735133..1736794)
Genome map
AA seq 553 aa AA seqDB search
MLEKFISRENFDSYEDFVENFKINIPGNFNFAYDVVDVMAQENPDKVAMVWCDDKGEEAV
FTFAQMKRYSNKAANFFKSLGIKKGDPVMLILKRRYEFWFCLLALHKIGAICIPATNLLT
TKDLVYRNNAADIKMVVAVADEEVLTHVDEAEKKSPTLVLKAAVGGQRDGWIDFNSELEK
ASEIFERPVGAEAPQNEDIMLLYFTSGTTGMPKMVQHNFTYPLGHILTAKYWQQVKEGGL
HLTVAETGWAKAVWGKIYGQWICGSAVFVYDFDKFIPKNLLKAIEKYGVTTFCAPPTIYR
FFIKEDLSQFDLSKLEHCSIAGEPLNPEVYEQWLKATGIKLMEGYGQTELTVTIATFPWL
EPKPGSMGKPAPGYEVDLIDENGNSCDVGEEGQIVIRTKGGKPFGMFDGYYRDAELTKKV
WHDDIYYTGDMAWRDEDGYYWFVGRADDVIKSSGYRIGPFEVESALLEHPAVLECAITGV
PDPVRGQVVKATVVLTQNYTPSDDLVKELQEHVKKVTAPYKYPRIIEFVDELPKTISGKI
RRVEIREQDKNKK
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgctggaaaaattcatttcaagggagaattttgattcgtacgaggattttgttgaaaat
ttcaagattaatatacccggtaatttcaactttgcctatgacgtggtagacgttatggct
caagaaaacccagacaaggtggctatggtctggtgcgatgataagggcgaagaagccgtt
tttacttttgcccagatgaagcgttatagcaataaagcggccaacttttttaaatcgctg
ggcattaaaaaaggggacccggtaatgcttattttaaaaaggcgttacgaattctggttc
tgcttgctggcgttgcataaaatcggggcaatatgtatccccgcaactaacttgctgacc
acaaaagatttagtttacagaaacaatgctgccgacataaaaatggtagtagccgtagcc
gatgaagaagttttaacacatgtggatgaagctgagaaaaaatccccaacgcttgtactc
aaagctgccgtgggcggtcagcgtgacggctggatcgactttaacagtgaactggaaaag
gcctcggaaatttttgaaaggcctgttggagcagaagctcctcaaaacgaggatattatg
ctcttatactttacttccggcactacgggaatgccgaagatggtgcagcataattttaca
taccccctgggccatatcctgacagccaagtactggcaacaggtcaaggagggcgggcta
cacctgactgttgcggaaacggggtgggccaaagctgtatggggtaaaatatatggccag
tggatttgtggcagtgcagtgtttgtttatgactttgacaaatttattccgaaaaatctt
ctaaaggcaatagaaaaatatggcgttaccacattttgcgctcccccgacaatctaccgg
ttctttatcaaagaagacttgagccagtttgaccttagcaagctggaacattgttctatc
gccggcgaacctttaaatcccgaagtatacgagcaatggctaaaagcaacaggtattaaa
cttatggagggttatggtcagaccgaattaacggtaacaattgccacttttccctggtta
gaaccgaagccgggttccatgggtaaaccggcaccgggttatgaggtggatttaattgat
gagaacggaaattcttgcgatgtgggggaagaaggtcagattgttatccgtaccaaagga
ggaaaaccttttggtatgttcgacggctattaccgggatgcggaattaaccaaaaaggtg
tggcacgatgatatctattataccggggatatggcatggcgcgatgaagacggttactac
tggtttgtgggtagggccgatgatgtgattaagagttcagggtaccggatcgggcccttt
gaagttgaaagtgcgcttctggagcacccggctgttcttgaatgtgcgataacgggtgtc
cctgaccctgtcagaggtcaagtagttaaggctactgtggttttgacccaaaattacacc
cccagtgatgacctggtcaaggaactgcaggaacatgtgaaaaaagtgactgcgccatat
aagtatccacggattatagaatttgtggatgaactgcccaaaaccatcagcggcaaaata
cgtagggtagaaataagggaacaagataagaacaagaagtag

DBGET integrated database retrieval system