KEGG   Thermincola potens JR: TherJR_1871Help
Entry
TherJR_1871       CDS       T01226                                 

Definition
phenylalanyl-tRNA synthetase subunit alpha (EC:6.1.1.20)
Orthology
K01889  
phenylalanyl-tRNA synthetase alpha chain [EC:6.1.1.20]
Organism
tjr  Thermincola potens JR
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:tjr00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1935706..1936728)
Genome map
AA seq 340 aa AA seqDB search
MQEDLQHMQTKGLAEIAEAATMDEVNEIRIKYLGKKGLLTGILRGMGSLSPDERPRVGQL
ANEVRAKLEEALAARLITLKEAARQERLRAEKIDVTLPGKVVQVGKKHPLTAVLDEIKEI
FVGLGYEIAEGPEVELEYYNFEALNIPPDHPARDMQDSFYISKGVLLRTHTSPVQPRVME
KKAPHVPVKIIAPGKVYRRDDDATHSPMFHQVEGLLIDRNVTFAELKGTLLSFARQMFGE
DREIRLRPSFFPFTEPSAEVDISCMACGGKGCRGCANTGWLEILGAGMIHPRVLEMSGYN
PEEVTGFAFGMGVERVAMLKYNIDDMRLLFENDKRFLEQF
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaggatttacagcacatgcagaccaaaggtttggcggaaatagccgaagctgca
acaatggatgaagttaatgaaataagaatcaagtacctgggtaaaaaagggctattaacg
ggtattctgcgcggaatgggaagcctgtcacccgatgagaggcccagggtaggccaactg
gccaacgaagtcagggccaagctggaagaggccctggcggccaggttgataactttgaag
gaggctgccaggcaggaacgtttacgggcagaaaaaatcgacgtgactttacccgggaag
gtcgtacaggtagggaaaaaacacccgttaacggcagtgctggatgaaattaaagagatt
tttgtcgggttaggttatgagatagccgagggcccagaggtagagcttgagtattataac
tttgaggcgctgaacattccgccggatcacccggcccgggatatgcaggattccttttat
ataagcaagggagttttactgcgcacccatacgtctccagttcagcccagggtaatggag
aaaaaggcgccgcatgtgccggtgaagattattgctccgggaaaagtatacaggcgtgac
gatgatgctacccattcaccgatgtttcaccaggtggaaggtttactaattgacaggaat
gttacttttgcagagctaaagggaactttattatcttttgcccgccagatgtttggggaa
gaccgggagattcgcttgcggccgagttttttcccctttaccgaacccagtgctgaggtg
gatatttcctgtatggcatgtggcggcaagggctgccggggatgcgccaataccggttgg
ctggagatactgggcgccggcatgattcacccgcgggtgctggaaatgtccggttacaat
cctgaagaggttaccgggtttgccttcggcatgggtgtggaacgggtggccatgctaaaa
tataacattgatgatatgcggttgctctttgagaacgacaagaggtttttggagcagttc
taa

DBGET integrated database retrieval system