KEGG   Thermincola potens: TherJR_1871Help
Entry
TherJR_1871       CDS       T01226                                 

Definition
phenylalanyl-tRNA synthetase subunit alpha (EC:6.1.1.20)
Orthology
K01889  
phenylalanyl-tRNA synthetase alpha chain [EC:6.1.1.20]
Organism
tjr  Thermincola potens
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:tjr00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    TherJR_1871
Enzymes [BR:tjr01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.20  phenylalanine---tRNA ligase
     TherJR_1871
Amino acid related enzymes [BR:tjr01007]
 Aminoacyl-tRNA synthetase
  Class II (U)
   TherJR_1871
Transfer RNA biogenesis [BR:tjr03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    TherJR_1871
 Prokaryotic Type
    TherJR_1871
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1935706..1936728)
Genome map
AA seq 340 aa AA seqDB search
MQEDLQHMQTKGLAEIAEAATMDEVNEIRIKYLGKKGLLTGILRGMGSLSPDERPRVGQL
ANEVRAKLEEALAARLITLKEAARQERLRAEKIDVTLPGKVVQVGKKHPLTAVLDEIKEI
FVGLGYEIAEGPEVELEYYNFEALNIPPDHPARDMQDSFYISKGVLLRTHTSPVQPRVME
KKAPHVPVKIIAPGKVYRRDDDATHSPMFHQVEGLLIDRNVTFAELKGTLLSFARQMFGE
DREIRLRPSFFPFTEPSAEVDISCMACGGKGCRGCANTGWLEILGAGMIHPRVLEMSGYN
PEEVTGFAFGMGVERVAMLKYNIDDMRLLFENDKRFLEQF
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaggatttacagcacatgcagaccaaaggtttggcggaaatagccgaagctgca
acaatggatgaagttaatgaaataagaatcaagtacctgggtaaaaaagggctattaacg
ggtattctgcgcggaatgggaagcctgtcacccgatgagaggcccagggtaggccaactg
gccaacgaagtcagggccaagctggaagaggccctggcggccaggttgataactttgaag
gaggctgccaggcaggaacgtttacgggcagaaaaaatcgacgtgactttacccgggaag
gtcgtacaggtagggaaaaaacacccgttaacggcagtgctggatgaaattaaagagatt
tttgtcgggttaggttatgagatagccgagggcccagaggtagagcttgagtattataac
tttgaggcgctgaacattccgccggatcacccggcccgggatatgcaggattccttttat
ataagcaagggagttttactgcgcacccatacgtctccagttcagcccagggtaatggag
aaaaaggcgccgcatgtgccggtgaagattattgctccgggaaaagtatacaggcgtgac
gatgatgctacccattcaccgatgtttcaccaggtggaaggtttactaattgacaggaat
gttacttttgcagagctaaagggaactttattatcttttgcccgccagatgtttggggaa
gaccgggagattcgcttgcggccgagttttttcccctttaccgaacccagtgctgaggtg
gatatttcctgtatggcatgtggcggcaagggctgccggggatgcgccaataccggttgg
ctggagatactgggcgccggcatgattcacccgcgggtgctggaaatgtccggttacaat
cctgaagaggttaccgggtttgccttcggcatgggtgtggaacgggtggccatgctaaaa
tataacattgatgatatgcggttgctctttgagaacgacaagaggtttttggagcagttc
taa

DBGET integrated database retrieval system