KEGG   Thermincola potens: TherJR_1931Help
Entry
TherJR_1931       CDS       T01226                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
tjr  Thermincola potens
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tjr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    TherJR_1931
Enzymes [BR:tjr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     TherJR_1931
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2005605..2006171)
Genome map
AA seq 188 aa AA seqDB search
MFDQQKLEQAVKMILEAIGEDPTREGLVDTPKRVARMYQEIFSGLEEDPKDHLKVLFTED
HEEMVLVKDIPFYSMCEHHLLPFFGRAHVAYIPRRGKITGLSKLARAVETIAKRPQLQER
LTCGIAEAIMESLNPLGVLVVVEAEHMCMTMRGVKKPGSMTVTSAVRGLFKTQEATRAEA
FALIRSQK
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaccaacaaaagctggagcaggccgtaaaaatgattttagaagccattggagag
gatcctacccgcgagggtctagtggatacccccaaaagggtggcccggatgtaccaggaa
atattttcagggctggaagaagatccgaaagatcacctgaaggtgttatttaccgaggat
catgaagaaatggtattggtaaaagacatccccttctattccatgtgcgagcaccatcta
ctgccctttttcgggcgggctcatgtagcttacattccccgtagagggaaaattaccggc
ctgtccaaattagccagggctgtcgaaactattgccaaacggcctcaacttcaggaaagg
ctgacctgcgggatagccgaagctattatggaaagccttaatccattaggtgtccttgta
gttgtggaagctgagcatatgtgtatgaccatgcggggggtcaaaaaacctggttccatg
acagtgacctccgctgtgcgcggtctgtttaagacgcaggaagctacaagggcggaggca
tttgcattaatcaggagccaaaagtag

DBGET integrated database retrieval system