KEGG   Thermincola potens: TherJR_2057Help
Entry
TherJR_2057       CDS       T01226                                 

Definition
(GenBank) class II aldolase/adducin family protein
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
tjr  Thermincola potens
Pathway
tjr00051  Fructose and mannose metabolism
tjr01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:tjr00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    TherJR_2057
Enzymes [BR:tjr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     TherJR_2057
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II Tnp_22_trimer
Motif
Other DBs
NCBI-ProteinID: ADG82902
JGI: TherJR_2057
UniProt: D5X8M6
Position
complement(2120220..2120777)
Genome map
AA seq 185 aa AA seqDB search
MLLKEFQLVGGGLFAAGLNNSHSGNLSVRAGKKIIITRRGSMLGHLTEKDLIETDLLKDG
PEHNLVSREIGVHRAVYLHTSAQALVHAHPIFATALSLVEDEIEPIDAEGKYYLKKVPVL
TVRETIGSAEVAEKLPLLLQENKIVVVKGHGTFAGGKTLEEAYQWTTSLENACKILYYTR
TLRAR
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
gtgctgctgaaggaatttcaattggtaggcggcggcctttttgccgccggtttaaataat
tcgcatagcggtaaccttagtgttagagcaggaaaaaagataattattaccaggcggggt
tccatgctgggccacctgacagagaaggaccttattgaaaccgacctgctgaaagatggt
cccgagcataaccttgtatcccgggaaatcggggtgcacagggcagtgtacctgcatact
tcggcccaggcgttagtccatgcccaccccatttttgccacggctttgtccttggtggaa
gatgaaattgaacccattgatgctgaaggtaaatactacttaaagaaagtgccggtgcta
accgtccgggaaacaataggttcggctgaggttgccgaaaagcttccgcttttgcttcag
gaaaacaaaattgtggtagtgaaagggcatggcacttttgcaggagggaaaacgctggag
gaagcttaccagtggacaacttcgctggaaaatgcgtgcaaaattctatattacacacgc
actttgcgtgcacgttaa

DBGET integrated database retrieval system