KEGG   Thermincola potens: TherJR_2165Help
Entry
TherJR_2165       CDS       T01226                                 

Definition
(GenBank) UDP-N-acetylmuramyl-tripeptide synthetase
  KO
K01928  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
tjr  Thermincola potens
Pathway
tjr00300  Lysine biosynthesis
tjr00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:tjr00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    TherJR_2165
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    TherJR_2165
Enzymes [BR:tjr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     TherJR_2165
Peptidoglycan biosynthesis and degradation proteins [BR:tjr01011]
 Precursor biosynthesis
  Amino acid ligase
   TherJR_2165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C Mur_ligase MoCF_biosynth RraA-like
Motif
Other DBs
NCBI-ProteinID: ADG83010
JGI: TherJR_2165
UniProt: D5X9A6
Position
complement(2237986..2239473)
Genome map
AA seq 495 aa AA seqDB search
MRRLTDLLKNIYGAQVQGDLTVQIEGLAYDSRKVQPGFAFICIEGYKTDGHLFAQNAVEN
GATVIIAEKPVTVPSSVTVVTVEDTREALAYMGAAFYDYPGDKLNIIGVTGTNGKTTTTH
LIENILVKAGKKVGLIGTIKNKIIDRVLPVTNTTPESLDLQALLAEMVDAGVDYAVMEVS
SHALELNRVAGCEYDQAIFTNITQDHLDFHETMDNYLAAKQKLFINLGKNSRKSRNKYGI
INIDDSKGQSFLEVTHGQVITYGIQSAADVRAEKIDLRSDGVSFTAVTPRGSVDLKLNLT
GLFNVYNSLAAVASGLGENIALPVIKEALEEVKGVPGRMEKVEAGQPFAVLVDYAHTPDG
LENVLSAAREFTKGRLITVFGCGGDRDRTKRPIMGEVSAKLSDFTVLTSDNPRSESPAEI
LRDIEEGVKPIIGPEKYTVIEDRKEAIRHALNMARAGDVVVIAGKGHETYQIVGTKVLPF
DDREVAMEILKEKFS
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgcgacgattaacggacctgctgaagaatatttacggtgcccaggtgcagggagatttg
acggtgcaaattgaggggctggcttatgattcgcggaaagtgcagcctggctttgccttt
atatgcatagaagggtacaagaccgacggtcatttgtttgcccaaaatgcggtagaaaac
ggggcgaccgttataattgcggaaaaacccgttaccgtaccgtcttctgttacagtggta
acggtggaggatacgcgggaagcactggcctatatgggggctgctttctacgattatcct
ggcgataagctgaatattatcggcgtaaccggtaccaatgggaaaaccaccactactcat
ctcatagaaaacatactggtcaaggccggtaagaaagtaggattaatcgggactattaaa
aataaaatcattgaccgggtgcttccggtaaccaatactacgccggaatctctggatttg
caggctttgttggcagaaatggttgatgcgggagtagattacgctgtgatggaagtgtca
tcccacgccctggaattgaacagggtagcgggctgcgaatatgaccaggccatctttacc
aatatcacccaggatcacctggactttcacgagactatggataactacctggcggccaaa
caaaaattattcattaatttaggaaaaaattctaggaagagcagaaataagtatggcata
attaatattgacgattccaaagggcagagctttctggaagttacacatggtcaggtaatt
acatacggaatacagtcagccgctgatgtgcgggcagagaaaattgacttgcgctccgat
ggggtcagcttcaccgctgttactcccaggggttccgttgatttgaagctaaatctgaca
ggcctgttcaatgtttacaactcattggcggcggtagcttccggtctgggcgaaaatatt
gctttgccggtaataaaggaagctctggaggaggtaaaaggggtaccgggtcggatggaa
aaagtggaagcaggccagcctttcgctgtgctggttgactatgctcatacaccggatggt
ttggaaaatgtacttagtgcagccagggagtttacgaaaggcagactgatcacggttttt
gggtgcgggggagaccgggaccggacaaaacgtcctatcatgggtgaagtttcggcgaag
ctcagtgattttaccgtacttacttctgataacccccgcagcgaaagcccggcagaaatc
ctgagagatattgaggaaggcgtcaaacctattatcgggccagaaaaatataccgttatc
gaggataggaaagaggctattaggcatgccctgaacatggctagagcgggtgacgtggtg
gttatagccggtaagggacatgaaacgtaccagattgtcgggacaaaggtgctacccttt
gacgaccgtgaggtcgctatggaaatattaaaagaaaagttttcctga

DBGET integrated database retrieval system