KEGG   Thermincola potens: TherJR_2507Help
Entry
TherJR_2507       CDS       T01226                                 

Definition
Aldehyde ferredoxin oxidoreductase (EC:1.2.7.5)
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
tjr  Thermincola potens
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tjr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TherJR_2507
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    TherJR_2507
Enzymes [BR:tjr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     TherJR_2507
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2602319..2604055)
Genome map
AA seq 578 aa AA seqDB search
MINANGIRVLEIDLNKQKIKAHNRKDLLAYLGGVGVATKLLDEYIMPEKDALDGDQPIVF
AIGPMETIFPVVTKVVAMFRSPLTGELGESYAGLRLGLAMRFTGYDAIVVKGKATKPTYL
VITADGVEFKNAEPLWGLTVEETGRILRRRETGSGLRSCIRIGRAGEKLISFAGVNVDTY
RHFGRLGLGAVFGSKNLKAMVVKGEEGLAITDKKEYQRVYKEIYQRVVETEVMDKYHGLG
TAVNVLPLNAMNGLPTKNMQAGSFAGAEEISGEAFAKHSLVRKLACSGCPIGCIHIAQVR
RQFGDHYEYYTTPISYDHELVFALGSFLGIDNRDELLELIEKTELYGLDSISTGVLLGWL
TEAFEKQLVREEMIGCRPAFGNASVYKEIIDRLVAMDSDFYRDLARGTWYAAAKYGGCDF
AMCLGGHEMAGYHTGHAFIFGQAVGARHSHLDNAGYSIDQKLQGWDPEQVVDKIINEEIE
RNILNSLVICLFARNVYDRRTVVSALRAIGLDWNEESLGELGKKVFRLKRDLKEKLGYRL
ENIYFPQRYFETKSFTGFVEEAKIKQLMDIYKSRYYTV
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
atgattaatgcgaacggtatcagggtattagagattgacctgaataagcaaaagataaag
gcgcataatcgcaaagatttactggcttatcttggcggggtaggtgtggccacaaaatta
ctggacgaatatataatgccggagaaggatgccttggacggtgaccaacctattgtcttc
gccataggacctatggaaacgatttttcccgtggtgaccaaggtagtggccatgtttcgt
tctcctttaacgggggagctgggtgaaagttatgcagggctgcggttgggactggccatg
cgttttaccgggtacgatgctatagttgtgaagggaaaagctactaagccaacttatctg
gtaattaccgctgacggagtggagtttaagaacgcagaacctttgtgggggctgactgtt
gaggagacaggccggattctccgcaggagagagaccggttccgggctgcgcagttgtatt
cgcattggtcgcgccggggaaaagttaatttcttttgccggtgtaaacgtggatacatac
cggcattttggccgcctgggactgggcgccgtttttggcagcaagaatttaaaagctatg
gtagtaaaaggggaagaggggctggctattactgataaaaaggaataccagcgggtttac
aaggaaatataccagagggttgtagaaacggaagtgatggataagtatcatgggctggga
acggctgtaaatgtcctgcctttaaatgccatgaacggtttgcctaccaagaacatgcag
gccgggagctttgcgggggcagaggagatcagcggcgaggcttttgccaagcacagtctg
gtcaggaaactggcttgctccgggtgtcccattggctgtattcacattgcccaggtcagg
cgccagttcggagaccattacgaatactatacaactcctatctcttacgatcatgagctg
gtttttgccctgggttcgttccttggtattgacaacagagacgaattgttggagttgatt
gaaaagacagagctttacggcctggacagtatttcaacgggggtactgctgggctggctg
acggaggcttttgaaaagcaactggttagggaagaaatgatcggctgtcggcctgccttt
ggcaatgcctctgtttacaaagagataattgaccggctggtggctatggattcggatttt
tacagggacctggcgagggggacatggtacgctgccgccaaatacggtggctgtgacttt
gccatgtgcctcggtggtcatgaaatggccggatatcacactggacacgcttttatattt
gggcaggccgtgggggcaagacactctcacctggataatgccggttactcgatagaccag
aagctgcaggggtgggaccctgaacaggtggttgacaaaattattaacgaggaaattgag
cgaaacatattaaactcccttgtcatctgcctgtttgcccggaacgtgtatgacaggcga
acggtggtttcagcgttaagagctattggcctggactggaatgaagaaagtttaggtgaa
ctcggaaagaaagttttccgattaaaacgcgatttaaaggaaaaactgggttaccgtctg
gaaaatatctattttccgcagcggtattttgaaaccaaaagctttaccggttttgtggaa
gaagcaaaaattaagcagcttatggacatttataagtccaggtattatacggtttaa

DBGET integrated database retrieval system