KEGG   Thermincola potens: TherJR_2721Help
Entry
TherJR_2721       CDS       T01226                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
tjr  Thermincola potens
Pathway
tjr00010  Glycolysis / Gluconeogenesis
tjr00052  Galactose metabolism
tjr00500  Starch and sucrose metabolism
tjr00520  Amino sugar and nucleotide sugar metabolism
tjr00521  Streptomycin biosynthesis
tjr01100  Metabolic pathways
tjr01110  Biosynthesis of secondary metabolites
tjr01120  Microbial metabolism in diverse environments
tjr01130  Biosynthesis of antibiotics
tjr01200  Carbon metabolism
Module
tjr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tjr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TherJR_2721
   00052 Galactose metabolism
    TherJR_2721
   00500 Starch and sucrose metabolism
    TherJR_2721
   00520 Amino sugar and nucleotide sugar metabolism
    TherJR_2721
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    TherJR_2721
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    TherJR_2721
Enzymes [BR:tjr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     TherJR_2721
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK FGGY_N BcrAD_BadFG
Motif
Other DBs
NCBI-ProteinID: ADG83555
JGI: TherJR_2721
UniProt: D5XCA3
Position
complement(2828598..2829572)
Genome map
AA seq 324 aa AA seqDB search
MAGNKEQYVIGIDLGGTFIKGALFNRRGKMLAKKEIPTLAAEGAEAVATRMAGLARDLQK
QAGVSMDMVIGMGIGSPGQIDGRTGCVIRSGNLGWHNVYILEMVKKHIPLPLFLENDATA
AALGEKWCGAGQQAENMIMMTIGTGIGGGIIINGRLYRGASSGAGEIGHMVIQPGGPLCS
CGNKGCLEALAAAPAIIKRAKAALAGGTASVLAETVDFTVRNVFDAVAKGDPVATRVVDE
TAYYLGIGVGSLINIFNPELVIIGGGVSKAGDLLFIPLCKYAEQNALPALWPSVRIVPAA
LGNDAGSVGAAAVALQRQGYGLYV
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggccggtaacaaagagcagtacgttattggcattgaccttggcggaacatttatcaag
ggggctcttttcaacaggcgtggcaaaatgctggccaaaaaagaaatccccaccctggcg
gcggaaggcgccgaggccgtagcgacaagaatggcgggcctggcccgggacctgcagaaa
caggcaggtgtgtctatggatatggtcatcggtatgggcataggttcgccggggcagatt
gatggccgtaccggctgtgtaatcaggtcaggtaacctcgggtggcataatgtgtacata
ctggaaatggtaaagaagcacatacccttgcctcttttcctggagaacgatgcaacggct
gcggcccttggcgaaaaatggtgcggtgcaggccaacaggccgagaatatgatcatgatg
accattggcacaggaataggaggcggcataatcatcaacggccggctttacagaggggct
tcttccggcgccggagaaataggccatatggttattcagcccggggggccgctctgcagt
tgcgggaataaaggatgtctggaagctttagccgctgcaccggccataattaaaagggct
aaagctgcgctggccgggggaacagcatctgtgctggcggaaactgttgattttactgtc
aggaatgtgtttgatgcggtagcgaaaggcgaccctgtagcgaccagggtggtggatgaa
actgcttattatctgggaataggcgtgggtagtctaataaacatttttaaccccgaactg
gtgataataggcggaggtgtttccaaggcgggagaccttttatttatacctctttgcaaa
tatgctgagcaaaatgctttaccggctctctggccctctgttaggattgttcctgccgct
ttgggcaatgatgccggtagcgtaggggctgctgccgttgccttacaaaggcaggggtac
ggtttatatgtgtaa

DBGET integrated database retrieval system