KEGG   Thermincola potens: TherJR_2899Help
Entry
TherJR_2899       CDS       T01226                                 

Definition
(GenBank) sugar-phosphate isomerase, RpiB/LacA/LacB family
  KO
K01808  ribose 5-phosphate isomerase B [EC:5.3.1.6]
Organism
tjr  Thermincola potens
Pathway
tjr00030  Pentose phosphate pathway
tjr00051  Fructose and mannose metabolism
tjr01100  Metabolic pathways
tjr01110  Biosynthesis of secondary metabolites
tjr01120  Microbial metabolism in diverse environments
tjr01130  Biosynthesis of antibiotics
tjr01200  Carbon metabolism
tjr01230  Biosynthesis of amino acids
Module
tjr_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:tjr00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    TherJR_2899
   00051 Fructose and mannose metabolism
    TherJR_2899
Enzymes [BR:tjr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     TherJR_2899
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LacAB_rpiB MSV199
Motif
Other DBs
NCBI-ProteinID: ADG83731
JGI: TherJR_2899
UniProt: D5XDI5
Position
complement(3032452..3032901)
Genome map
AA seq 149 aa AA seqDB search
MKVAIGSDHGGFRLKEEIKKFLTEENIEFKDFGTYSEDAVDYPDISYPVAKAVQKGEYTR
GILICGTGIGIGIAANKLPGIRAALCHDTFSARASREHNDANILTMGERVIGPGLAKDIV
KIWLSTEFAGGRHLRRVQKICQLEEKRDY
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagtagcaataggttccgaccacggggggttccgtttaaaggaggaaataaaaaaa
tttttgacggaagaaaatattgaattcaaagactttggcacctattccgaggatgccgtt
gattatcctgatatatcttatccggtggcaaaagcggtacaaaaaggcgaatataccaga
ggaatccttatatgcgggaccggcatcgggatcggtatcgcagccaataaactgcccggc
ataagagcggctttatgccatgataccttttccgccagggcatcacgggagcataatgac
gccaacatactgaccatgggcgaacgggtaataggtcccggactggccaaggatattgtc
aagatatggctgtctacagaatttgccggtggcaggcacttacgaagggtgcaaaaaata
tgtcaactggaggagaaacgtgattattaa

DBGET integrated database retrieval system