KEGG   Thermincola potens: TherJR_2899Help
Entry
TherJR_2899       CDS       T01226                                 

Definition
RpiB/LacA/LacB family sugar-phosphate isomerase (EC:5.3.1.26)
Orthology
K01808  
ribose 5-phosphate isomerase B [EC:5.3.1.6]
Organism
tjr  Thermincola potens
Pathway
Pentose phosphate pathway
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:tjr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TherJR_2899
   01230 Biosynthesis of amino acids
    TherJR_2899
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    TherJR_2899
   00051 Fructose and mannose metabolism
    TherJR_2899
Enzymes [BR:tjr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     TherJR_2899
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3032452..3032901)
Genome map
AA seq 149 aa AA seqDB search
MKVAIGSDHGGFRLKEEIKKFLTEENIEFKDFGTYSEDAVDYPDISYPVAKAVQKGEYTR
GILICGTGIGIGIAANKLPGIRAALCHDTFSARASREHNDANILTMGERVIGPGLAKDIV
KIWLSTEFAGGRHLRRVQKICQLEEKRDY
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagtagcaataggttccgaccacggggggttccgtttaaaggaggaaataaaaaaa
tttttgacggaagaaaatattgaattcaaagactttggcacctattccgaggatgccgtt
gattatcctgatatatcttatccggtggcaaaagcggtacaaaaaggcgaatataccaga
ggaatccttatatgcgggaccggcatcgggatcggtatcgcagccaataaactgcccggc
ataagagcggctttatgccatgataccttttccgccagggcatcacgggagcataatgac
gccaacatactgaccatgggcgaacgggtaataggtcccggactggccaaggatattgtc
aagatatggctgtctacagaatttgccggtggcaggcacttacgaagggtgcaaaaaata
tgtcaactggaggagaaacgtgattattaa

DBGET integrated database retrieval system